BLASTX nr result
ID: Angelica22_contig00030707
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00030707 (348 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002303410.1| predicted protein [Populus trichocarpa] gi|2... 66 3e-09 ref|NP_001242667.1| uncharacterized protein LOC100788419 [Glycin... 60 2e-07 gb|AFK48391.1| unknown [Medicago truncatula] 55 6e-06 gb|AFK38409.1| unknown [Medicago truncatula] 55 6e-06 ref|XP_003629290.1| Ribosomal RNA small subunit methyltransferas... 55 6e-06 >ref|XP_002303410.1| predicted protein [Populus trichocarpa] gi|222840842|gb|EEE78389.1| predicted protein [Populus trichocarpa] Length = 394 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +1 Query: 220 RLKPRREAYLKDIEAETKCKLQKVEWLLNFYPLPPHVMIAKSK 348 RLKP EAYL++IEAE KC+LQK+ WL FY LPPH+ IA SK Sbjct: 39 RLKPGSEAYLEEIEAEIKCRLQKLNWLPGFYSLPPHIQIANSK 81 >ref|NP_001242667.1| uncharacterized protein LOC100788419 [Glycine max] gi|255642235|gb|ACU21382.1| unknown [Glycine max] Length = 392 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = +1 Query: 220 RLKPRREAYLKDIEAETKCKLQKVEWLLNFYPLPPHVMIAKSK 348 RLKP E+ ++++EAE KCKL+K+EWL FY LPPHV IA S+ Sbjct: 40 RLKPGFESCIEEVEAEVKCKLEKLEWLPGFYSLPPHVQIAGSR 82 >gb|AFK48391.1| unknown [Medicago truncatula] Length = 311 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/43 (53%), Positives = 32/43 (74%) Frame = +1 Query: 220 RLKPRREAYLKDIEAETKCKLQKVEWLLNFYPLPPHVMIAKSK 348 RLKP E Y+++ E+E KCK QK++WL FY LPP++ IA +K Sbjct: 39 RLKPGFEDYIEEFESEVKCKPQKLDWLPGFYTLPPNIQIASTK 81 >gb|AFK38409.1| unknown [Medicago truncatula] Length = 389 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/43 (53%), Positives = 32/43 (74%) Frame = +1 Query: 220 RLKPRREAYLKDIEAETKCKLQKVEWLLNFYPLPPHVMIAKSK 348 RLKP E Y+++ E+E KCK QK++WL FY LPP++ IA +K Sbjct: 39 RLKPGFEDYIEEFESEVKCKPQKLDWLPGFYTLPPNIQIASTK 81 >ref|XP_003629290.1| Ribosomal RNA small subunit methyltransferase, putative [Medicago truncatula] gi|355523312|gb|AET03766.1| Ribosomal RNA small subunit methyltransferase, putative [Medicago truncatula] Length = 389 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/43 (53%), Positives = 32/43 (74%) Frame = +1 Query: 220 RLKPRREAYLKDIEAETKCKLQKVEWLLNFYPLPPHVMIAKSK 348 RLKP E Y+++ E+E KCK QK++WL FY LPP++ IA +K Sbjct: 39 RLKPGFEDYIEEFESEVKCKPQKLDWLPGFYTLPPNIQIASTK 81