BLASTX nr result
ID: Angelica22_contig00030682
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00030682 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002321546.1| predicted protein [Populus trichocarpa] gi|2... 104 8e-21 ref|XP_002511487.1| DNA binding protein, putative [Ricinus commu... 98 8e-19 emb|CBI32056.3| unnamed protein product [Vitis vinifera] 97 1e-18 ref|XP_002272776.1| PREDICTED: transcription factor BPE-like [Vi... 97 1e-18 emb|CAN69076.1| hypothetical protein VITISV_004761 [Vitis vinifera] 97 1e-18 >ref|XP_002321546.1| predicted protein [Populus trichocarpa] gi|222868542|gb|EEF05673.1| predicted protein [Populus trichocarpa] Length = 213 Score = 104 bits (259), Expect = 8e-21 Identities = 55/71 (77%), Positives = 59/71 (83%), Gaps = 2/71 (2%) Frame = -1 Query: 207 KRMKASGSRDENPESKVETEAKSAG--KQSEQSVKPTEPSKQDYIHVRARRGQATDSHSL 34 KR K SGSR EN +S+ ETEA SA K +EQS KP+EP KQDYIHVRARRGQATDSHSL Sbjct: 38 KRRKISGSRSENNDSRAETEASSAANNKTAEQSSKPSEPPKQDYIHVRARRGQATDSHSL 97 Query: 33 AERARREKISE 1 AERARREKISE Sbjct: 98 AERARREKISE 108 >ref|XP_002511487.1| DNA binding protein, putative [Ricinus communis] gi|223550602|gb|EEF52089.1| DNA binding protein, putative [Ricinus communis] Length = 275 Score = 97.8 bits (242), Expect = 8e-19 Identities = 52/71 (73%), Positives = 59/71 (83%), Gaps = 2/71 (2%) Frame = -1 Query: 207 KRMKASGSRDENPESKVETEAKSAGKQS--EQSVKPTEPSKQDYIHVRARRGQATDSHSL 34 KRMK SGS++EN +SK E EA SA ++ EQ+ K +EP KQDYIHVRARRGQATDSHSL Sbjct: 100 KRMKISGSQNENGKSKAEVEASSANDKNAAEQNSKISEPPKQDYIHVRARRGQATDSHSL 159 Query: 33 AERARREKISE 1 AERARREKISE Sbjct: 160 AERARREKISE 170 >emb|CBI32056.3| unnamed protein product [Vitis vinifera] Length = 208 Score = 97.4 bits (241), Expect = 1e-18 Identities = 50/69 (72%), Positives = 57/69 (82%) Frame = -1 Query: 207 KRMKASGSRDENPESKVETEAKSAGKQSEQSVKPTEPSKQDYIHVRARRGQATDSHSLAE 28 KR+K SGSRDEN +SK E E S+GK EQ+ + +P KQD+IHVRARRGQATDSHSLAE Sbjct: 39 KRLKTSGSRDENRDSKTEVET-SSGKPVEQNPQSADPPKQDFIHVRARRGQATDSHSLAE 97 Query: 27 RARREKISE 1 RARREKISE Sbjct: 98 RARREKISE 106 >ref|XP_002272776.1| PREDICTED: transcription factor BPE-like [Vitis vinifera] Length = 277 Score = 97.4 bits (241), Expect = 1e-18 Identities = 50/69 (72%), Positives = 57/69 (82%) Frame = -1 Query: 207 KRMKASGSRDENPESKVETEAKSAGKQSEQSVKPTEPSKQDYIHVRARRGQATDSHSLAE 28 KR+K SGSRDEN +SK E E S+GK EQ+ + +P KQD+IHVRARRGQATDSHSLAE Sbjct: 108 KRLKTSGSRDENRDSKTEVET-SSGKPVEQNPQSADPPKQDFIHVRARRGQATDSHSLAE 166 Query: 27 RARREKISE 1 RARREKISE Sbjct: 167 RARREKISE 175 >emb|CAN69076.1| hypothetical protein VITISV_004761 [Vitis vinifera] Length = 302 Score = 97.4 bits (241), Expect = 1e-18 Identities = 50/69 (72%), Positives = 57/69 (82%) Frame = -1 Query: 207 KRMKASGSRDENPESKVETEAKSAGKQSEQSVKPTEPSKQDYIHVRARRGQATDSHSLAE 28 KR+K SGSRDEN +SK E E S+GK EQ+ + +P KQD+IHVRARRGQATDSHSLAE Sbjct: 108 KRLKTSGSRDENRDSKTEVET-SSGKPVEQNPQSADPPKQDFIHVRARRGQATDSHSLAE 166 Query: 27 RARREKISE 1 RARREKISE Sbjct: 167 RARREKISE 175