BLASTX nr result
ID: Angelica22_contig00030431
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00030431 (247 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002887644.1| hypothetical protein ARALYDRAFT_895536 [Arab... 91 1e-16 dbj|BAH57041.1| AT1G76520 [Arabidopsis thaliana] 91 1e-16 ref|NP_565133.1| auxin efflux carrier-like protein [Arabidopsis ... 91 1e-16 gb|AAM62517.1| unknown [Arabidopsis thaliana] 91 1e-16 ref|NP_683316.2| auxin efflux carrier-like protein [Arabidopsis ... 86 2e-15 >ref|XP_002887644.1| hypothetical protein ARALYDRAFT_895536 [Arabidopsis lyrata subsp. lyrata] gi|297333485|gb|EFH63903.1| hypothetical protein ARALYDRAFT_895536 [Arabidopsis lyrata subsp. lyrata] Length = 391 Score = 90.5 bits (223), Expect = 1e-16 Identities = 37/49 (75%), Positives = 46/49 (93%) Frame = +1 Query: 97 RRWFMPVNVFLTFLIGSLLGWLVNLITRPPTHLRGLVIGCCAAGNLGNI 243 + WFMPVNV LTF+IGSLLGW+V +IT+PP+HLRGL++GCCAAGNLGN+ Sbjct: 72 KMWFMPVNVLLTFIIGSLLGWIVIVITKPPSHLRGLILGCCAAGNLGNM 120 >dbj|BAH57041.1| AT1G76520 [Arabidopsis thaliana] Length = 255 Score = 90.5 bits (223), Expect = 1e-16 Identities = 37/49 (75%), Positives = 46/49 (93%) Frame = +1 Query: 97 RRWFMPVNVFLTFLIGSLLGWLVNLITRPPTHLRGLVIGCCAAGNLGNI 243 + WFMPVNV LTF+IGSLLGW+V +IT+PP+HLRGL++GCCAAGNLGN+ Sbjct: 72 KMWFMPVNVLLTFIIGSLLGWIVIVITKPPSHLRGLILGCCAAGNLGNM 120 >ref|NP_565133.1| auxin efflux carrier-like protein [Arabidopsis thaliana] gi|30699180|ref|NP_849892.1| auxin efflux carrier-like protein [Arabidopsis thaliana] gi|12323984|gb|AAG51955.1|AC015450_16 unknown protein; 51686-53591 [Arabidopsis thaliana] gi|20466518|gb|AAM20576.1| unknown protein [Arabidopsis thaliana] gi|23198174|gb|AAN15614.1| unknown protein [Arabidopsis thaliana] gi|110742076|dbj|BAE98969.1| hypothetical protein [Arabidopsis thaliana] gi|332197733|gb|AEE35854.1| auxin efflux carrier-like protein [Arabidopsis thaliana] gi|332197734|gb|AEE35855.1| auxin efflux carrier-like protein [Arabidopsis thaliana] Length = 390 Score = 90.5 bits (223), Expect = 1e-16 Identities = 37/49 (75%), Positives = 46/49 (93%) Frame = +1 Query: 97 RRWFMPVNVFLTFLIGSLLGWLVNLITRPPTHLRGLVIGCCAAGNLGNI 243 + WFMPVNV LTF+IGSLLGW+V +IT+PP+HLRGL++GCCAAGNLGN+ Sbjct: 72 KMWFMPVNVLLTFIIGSLLGWIVIVITKPPSHLRGLILGCCAAGNLGNM 120 >gb|AAM62517.1| unknown [Arabidopsis thaliana] Length = 390 Score = 90.5 bits (223), Expect = 1e-16 Identities = 37/49 (75%), Positives = 46/49 (93%) Frame = +1 Query: 97 RRWFMPVNVFLTFLIGSLLGWLVNLITRPPTHLRGLVIGCCAAGNLGNI 243 + WFMPVNV LTF+IGSLLGW+V +IT+PP+HLRGL++GCCAAGNLGN+ Sbjct: 72 KMWFMPVNVLLTFIIGSLLGWIVIVITKPPSHLRGLILGCCAAGNLGNM 120 >ref|NP_683316.2| auxin efflux carrier-like protein [Arabidopsis thaliana] gi|332191921|gb|AEE30042.1| auxin efflux carrier-like protein [Arabidopsis thaliana] Length = 472 Score = 86.3 bits (212), Expect = 2e-15 Identities = 34/49 (69%), Positives = 44/49 (89%) Frame = +1 Query: 97 RRWFMPVNVFLTFLIGSLLGWLVNLITRPPTHLRGLVIGCCAAGNLGNI 243 + WFMP+NV LTF+IGS LGW+V IT+PP+HLRG+++GCCAAGNLGN+ Sbjct: 159 KMWFMPLNVLLTFIIGSFLGWIVIKITKPPSHLRGIIVGCCAAGNLGNM 207