BLASTX nr result
ID: Angelica22_contig00030421
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00030421 (355 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002330990.1| predicted protein [Populus trichocarpa] gi|2... 120 1e-25 ref|XP_002323301.1| predicted protein [Populus trichocarpa] gi|2... 104 7e-21 ref|XP_002534272.1| ATP binding protein, putative [Ricinus commu... 102 4e-20 ref|XP_003520530.1| PREDICTED: probable inactive leucine-rich re... 101 6e-20 ref|XP_002881831.1| leucine-rich repeat family protein [Arabidop... 101 7e-20 >ref|XP_002330990.1| predicted protein [Populus trichocarpa] gi|222872920|gb|EEF10051.1| predicted protein [Populus trichocarpa] Length = 652 Score = 120 bits (301), Expect = 1e-25 Identities = 59/88 (67%), Positives = 72/88 (81%) Frame = -1 Query: 298 TAFIFFTLSLHYSTYITLSLNSDGLSLLALKSAITTDPTRTLTFWSETDPTPCHWQGITC 119 TAF+ T++ +++LSLN+DGL+LLALK+AITTDPT TL W+ETDPTPCHW GITC Sbjct: 9 TAFLV-TITFTNLRFLSLSLNTDGLALLALKAAITTDPTDTLASWTETDPTPCHWHGITC 67 Query: 118 DNTTHKVTSISLSNKNLTGYIPSELGTI 35 N H+VTS+SL NKNLTGYIPSELG + Sbjct: 68 IN--HRVTSLSLPNKNLTGYIPSELGLL 93 >ref|XP_002323301.1| predicted protein [Populus trichocarpa] gi|222867931|gb|EEF05062.1| predicted protein [Populus trichocarpa] Length = 652 Score = 104 bits (260), Expect = 7e-21 Identities = 50/70 (71%), Positives = 57/70 (81%) Frame = -1 Query: 244 SLNSDGLSLLALKSAITTDPTRTLTFWSETDPTPCHWQGITCDNTTHKVTSISLSNKNLT 65 SLN+DGL+LLALK+AIT DPT TL WSETDPTPCHW GITC N +VTS+SL +KN T Sbjct: 25 SLNTDGLALLALKAAITADPTDTLASWSETDPTPCHWHGITCIN--DRVTSLSLPDKNFT 82 Query: 64 GYIPSELGTI 35 GYIP ELG + Sbjct: 83 GYIPFELGLL 92 >ref|XP_002534272.1| ATP binding protein, putative [Ricinus communis] gi|223525595|gb|EEF28109.1| ATP binding protein, putative [Ricinus communis] Length = 654 Score = 102 bits (253), Expect = 4e-20 Identities = 47/73 (64%), Positives = 58/73 (79%) Frame = -1 Query: 253 ITLSLNSDGLSLLALKSAITTDPTRTLTFWSETDPTPCHWQGITCDNTTHKVTSISLSNK 74 ++ SL DGL+LLALK+AITTDPTR L WS++D TPCHW GITC N H+VTS+ L NK Sbjct: 19 LSFSLTRDGLALLALKAAITTDPTRVLDSWSDSDQTPCHWHGITCIN--HRVTSLILPNK 76 Query: 73 NLTGYIPSELGTI 35 + TGY+PSELG + Sbjct: 77 SFTGYLPSELGLL 89 >ref|XP_003520530.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At1g66830-like [Glycine max] Length = 653 Score = 101 bits (252), Expect = 6e-20 Identities = 50/68 (73%), Positives = 54/68 (79%) Frame = -1 Query: 244 SLNSDGLSLLALKSAITTDPTRTLTFWSETDPTPCHWQGITCDNTTHKVTSISLSNKNLT 65 SLNSDGLSLLALK+A+ DPT LT WSETD TPCHW GI+C T KVT +SL KNLT Sbjct: 28 SLNSDGLSLLALKAAVDADPTGVLTSWSETDVTPCHWPGISC--TGDKVTQLSLPRKNLT 85 Query: 64 GYIPSELG 41 GYIPSELG Sbjct: 86 GYIPSELG 93 >ref|XP_002881831.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297327670|gb|EFH58090.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Length = 643 Score = 101 bits (251), Expect = 7e-20 Identities = 48/70 (68%), Positives = 56/70 (80%) Frame = -1 Query: 244 SLNSDGLSLLALKSAITTDPTRTLTFWSETDPTPCHWQGITCDNTTHKVTSISLSNKNLT 65 SLNSDGLSLLALKSA+ DPTR +T WSE+DPTPCHW GI C T +VTS+ L K+L+ Sbjct: 23 SLNSDGLSLLALKSAVDNDPTRVMTHWSESDPTPCHWSGIVC--TNGRVTSLVLFAKSLS 80 Query: 64 GYIPSELGTI 35 GYIPSELG + Sbjct: 81 GYIPSELGLL 90