BLASTX nr result
ID: Angelica22_contig00030194
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00030194 (204 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533006.1| RNA binding protein, putative [Ricinus commu... 55 8e-06 >ref|XP_002533006.1| RNA binding protein, putative [Ricinus communis] gi|223527217|gb|EEF29381.1| RNA binding protein, putative [Ricinus communis] Length = 197 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/76 (34%), Positives = 39/76 (51%), Gaps = 9/76 (11%) Frame = -2 Query: 203 IAWNIWTHRNSVVWKNIFQRPSTVVNGAGALLFQWQNAQVK*VISAKTNP---------R 51 + WN+W HRN VVW + ++P+ +V+GA L +W +I+ +TNP Sbjct: 76 LVWNLWIHRNEVVWYSKRKQPTQIVDGAVTYLHKW-------LIAQQTNPPSPDNSGLFH 128 Query: 50 EGVLIWKKPVHGWVTC 3 + WKKP GW C Sbjct: 129 HNLAKWKKPKTGWPKC 144