BLASTX nr result
ID: Angelica22_contig00030146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00030146 (356 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535451.1| conserved hypothetical protein [Ricinus comm... 81 8e-14 ref|XP_002523280.1| conserved hypothetical protein [Ricinus comm... 66 3e-09 >ref|XP_002535451.1| conserved hypothetical protein [Ricinus communis] gi|223523062|gb|EEF26930.1| conserved hypothetical protein [Ricinus communis] Length = 115 Score = 81.3 bits (199), Expect = 8e-14 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 121 RGVSTSLARGWDSFTCIPASTTKSSGLNAPTTAVQPFLGF 2 RGVSTSLARGWDSFTCIPASTTKSSGLNA TTAVQPFLGF Sbjct: 20 RGVSTSLARGWDSFTCIPASTTKSSGLNALTTAVQPFLGF 59 >ref|XP_002523280.1| conserved hypothetical protein [Ricinus communis] gi|223537493|gb|EEF39119.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 66.2 bits (160), Expect = 3e-09 Identities = 33/39 (84%), Positives = 33/39 (84%) Frame = -2 Query: 118 GVSTSLARGWDSFTCIPASTTKSSGLNAPTTAVQPFLGF 2 G STSLARGWDSFTCI ASTTKSS LNA TT VQPFL F Sbjct: 24 GRSTSLARGWDSFTCISASTTKSSSLNALTTLVQPFLEF 62