BLASTX nr result
ID: Angelica22_contig00030117
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00030117 (354 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306963.1| predicted protein [Populus trichocarpa] gi|2... 112 2e-23 ref|XP_004144925.1| PREDICTED: mechanosensitive ion channel prot... 103 1e-20 ref|XP_002889201.1| mechanosensitive ion channel domain-containi... 101 6e-20 ref|NP_177982.1| mechanosensitive channel of small conductance-l... 100 1e-19 ref|XP_002317440.1| predicted protein [Populus trichocarpa] gi|2... 100 2e-19 >ref|XP_002306963.1| predicted protein [Populus trichocarpa] gi|222856412|gb|EEE93959.1| predicted protein [Populus trichocarpa] Length = 300 Score = 112 bits (281), Expect = 2e-23 Identities = 49/71 (69%), Positives = 64/71 (90%) Frame = -1 Query: 354 RLKISIWLSHRMNFQDMGERWVRRALLVEEIIKVCRELDIEYRMLPVDVNVRNMPATVSN 175 ++K+S+W++HRMN Q+M ERWVRR LL+ E+IKV +ELDIEYR+LP+DVN+RNMP VSN Sbjct: 230 KMKMSLWVTHRMNHQEMEERWVRRNLLLGEMIKVFKELDIEYRVLPLDVNIRNMPPLVSN 289 Query: 174 RLPSNWTSCAD 142 RLPSNWT+CA+ Sbjct: 290 RLPSNWTTCAN 300 >ref|XP_004144925.1| PREDICTED: mechanosensitive ion channel protein 6-like [Cucumis sativus] gi|449529323|ref|XP_004171649.1| PREDICTED: mechanosensitive ion channel protein 6-like [Cucumis sativus] Length = 955 Score = 103 bits (257), Expect = 1e-20 Identities = 43/71 (60%), Positives = 62/71 (87%), Gaps = 1/71 (1%) Frame = -1 Query: 354 RLKISIWLSHRMNFQDMGERWVRRALLVEEIIKVCRELDIEYRMLPVDVNVRNMPATV-S 178 ++K+++WLSHRMN QD GERW RR++LVEE++KVC+ELDI+YR+LP+D+N+R++P++ S Sbjct: 884 KVKLAVWLSHRMNHQDSGERWARRSVLVEEVVKVCQELDIQYRLLPIDINIRSLPSSAPS 943 Query: 177 NRLPSNWTSCA 145 PSNWTS A Sbjct: 944 IGFPSNWTSPA 954 >ref|XP_002889201.1| mechanosensitive ion channel domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297335042|gb|EFH65460.1| mechanosensitive ion channel domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 857 Score = 101 bits (252), Expect = 6e-20 Identities = 45/73 (61%), Positives = 60/73 (82%), Gaps = 4/73 (5%) Frame = -1 Query: 351 LKISIWLSHRMNFQDMGERWVRRALLVEEIIKVCRELDIEYRMLPVDVNVRNMPAT---- 184 ++I++W +HRMN QDMGE+W RR+ LVEEI K+CRELDIEYR+ P+D+NVRNMP + Sbjct: 781 VRIAVWPTHRMNHQDMGEKWARRSQLVEEIAKICRELDIEYRLYPLDINVRNMPTSTVLP 840 Query: 183 VSNRLPSNWTSCA 145 VS+RLP NW++ A Sbjct: 841 VSDRLPPNWSAPA 853 >ref|NP_177982.1| mechanosensitive channel of small conductance-like 6 [Arabidopsis thaliana] gi|75213461|sp|Q9SYM1.1|MSL6_ARATH RecName: Full=Mechanosensitive ion channel protein 6; AltName: Full=Mechanosensitive channel of small conductance-like 6; AltName: Full=MscS-Like protein 6 gi|4836872|gb|AAD30575.1|AC007260_6 Hypothetical protein [Arabidopsis thaliana] gi|332198006|gb|AEE36127.1| mechanosensitive channel of small conductance-like 6 [Arabidopsis thaliana] Length = 856 Score = 100 bits (249), Expect = 1e-19 Identities = 44/73 (60%), Positives = 60/73 (82%), Gaps = 4/73 (5%) Frame = -1 Query: 351 LKISIWLSHRMNFQDMGERWVRRALLVEEIIKVCRELDIEYRMLPVDVNVRNMPAT---- 184 ++I++W +HRMN QDMGE+W RR+ LVEEI K+CRELDIEYR+ P+D+NVRN+P + Sbjct: 780 VRIAVWPTHRMNHQDMGEKWARRSQLVEEIAKICRELDIEYRLYPLDINVRNLPTSTALP 839 Query: 183 VSNRLPSNWTSCA 145 VS+RLP NW++ A Sbjct: 840 VSDRLPPNWSAPA 852 >ref|XP_002317440.1| predicted protein [Populus trichocarpa] gi|222860505|gb|EEE98052.1| predicted protein [Populus trichocarpa] Length = 555 Score = 99.8 bits (247), Expect = 2e-19 Identities = 40/67 (59%), Positives = 61/67 (91%) Frame = -1 Query: 354 RLKISIWLSHRMNFQDMGERWVRRALLVEEIIKVCRELDIEYRMLPVDVNVRNMPATVSN 175 R++I++WL+HRMN QDMGER+VRR+LL++E++++ RELD++YR+LP+D+NVR +P S+ Sbjct: 489 RVRIAVWLTHRMNHQDMGERFVRRSLLLDEMMRIFRELDMQYRLLPLDINVRALPPVTSD 548 Query: 174 RLPSNWT 154 RLP+NWT Sbjct: 549 RLPANWT 555