BLASTX nr result
ID: Angelica22_contig00030116
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00030116 (240 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635310.1| PREDICTED: uncharacterized protein LOC100854... 110 1e-22 emb|CBI41058.3| unnamed protein product [Vitis vinifera] 110 1e-22 ref|XP_003632960.1| PREDICTED: uncharacterized protein LOC100854... 110 1e-22 ref|XP_002518410.1| conserved hypothetical protein [Ricinus comm... 104 9e-21 ref|XP_002531193.1| conserved hypothetical protein [Ricinus comm... 102 2e-20 >ref|XP_003635310.1| PREDICTED: uncharacterized protein LOC100854148 [Vitis vinifera] Length = 448 Score = 110 bits (275), Expect = 1e-22 Identities = 49/79 (62%), Positives = 57/79 (72%) Frame = +2 Query: 2 RFLFLDKLCGVSTKVQRGYAQQVHTSMRILCAFVLPCFAADCIYKIWWFTSGRNQIPYFI 181 R LFLDKLC VS KV+ GY QQ+H SM++L FVLPCFA + YKIWW+ +G QIPY Sbjct: 129 RSLFLDKLCDVSEKVRLGYTQQLHRSMKLLSLFVLPCFAVEIAYKIWWYITGATQIPYLG 188 Query: 182 NAYLSHTVACIFLLSSWLY 238 N YLSH +AC L SWLY Sbjct: 189 NIYLSHAIACTLELCSWLY 207 >emb|CBI41058.3| unnamed protein product [Vitis vinifera] Length = 416 Score = 110 bits (275), Expect = 1e-22 Identities = 49/79 (62%), Positives = 57/79 (72%) Frame = +2 Query: 2 RFLFLDKLCGVSTKVQRGYAQQVHTSMRILCAFVLPCFAADCIYKIWWFTSGRNQIPYFI 181 R LFLDKLC VS KV+ GY QQ+H SM++L FVLPCFA + YKIWW+ +G QIPY Sbjct: 97 RSLFLDKLCDVSEKVRLGYTQQLHRSMKLLSLFVLPCFAVEIAYKIWWYITGATQIPYLG 156 Query: 182 NAYLSHTVACIFLLSSWLY 238 N YLSH +AC L SWLY Sbjct: 157 NIYLSHAIACTLELCSWLY 175 >ref|XP_003632960.1| PREDICTED: uncharacterized protein LOC100854830 [Vitis vinifera] Length = 430 Score = 110 bits (275), Expect = 1e-22 Identities = 49/79 (62%), Positives = 57/79 (72%) Frame = +2 Query: 2 RFLFLDKLCGVSTKVQRGYAQQVHTSMRILCAFVLPCFAADCIYKIWWFTSGRNQIPYFI 181 R LFLDKLC VS KV+ GY QQ+H SM++L FVLPCFA + YKIWW+ +G QIPY Sbjct: 111 RSLFLDKLCDVSEKVRLGYTQQLHRSMKLLSLFVLPCFAVEIAYKIWWYITGATQIPYLG 170 Query: 182 NAYLSHTVACIFLLSSWLY 238 N YLSH +AC L SWLY Sbjct: 171 NIYLSHAIACTLELCSWLY 189 >ref|XP_002518410.1| conserved hypothetical protein [Ricinus communis] gi|223542255|gb|EEF43797.1| conserved hypothetical protein [Ricinus communis] Length = 386 Score = 104 bits (259), Expect = 9e-21 Identities = 43/79 (54%), Positives = 58/79 (73%) Frame = +2 Query: 2 RFLFLDKLCGVSTKVQRGYAQQVHTSMRILCAFVLPCFAADCIYKIWWFTSGRNQIPYFI 181 +FLFLDKL + +++RGY +Q+ SM++LC FVLPC A+ Y+IWW+T+G QIPYF Sbjct: 112 KFLFLDKLDDEAERIRRGYKEQLQKSMKLLCIFVLPCLTAEAAYRIWWYTTGATQIPYFE 171 Query: 182 NAYLSHTVACIFLLSSWLY 238 N Y+S T+ACI L SW Y Sbjct: 172 NKYVSDTIACILQLCSWAY 190 >ref|XP_002531193.1| conserved hypothetical protein [Ricinus communis] gi|223529195|gb|EEF31170.1| conserved hypothetical protein [Ricinus communis] Length = 391 Score = 102 bits (255), Expect = 2e-20 Identities = 46/79 (58%), Positives = 57/79 (72%) Frame = +2 Query: 2 RFLFLDKLCGVSTKVQRGYAQQVHTSMRILCAFVLPCFAADCIYKIWWFTSGRNQIPYFI 181 RFLFLDKLC S V++GY Q++ S+++L FVLPCF A+ YKIWW+ SG +QIP+ Sbjct: 76 RFLFLDKLCDESETVRKGYTDQLNWSLKLLSIFVLPCFVAESAYKIWWYASGASQIPFLG 135 Query: 182 NAYLSHTVACIFLLSSWLY 238 N LS TVACI L SWLY Sbjct: 136 NVILSDTVACIMELCSWLY 154