BLASTX nr result
ID: Angelica22_contig00030110
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00030110 (237 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003544134.1| PREDICTED: probable sugar phosphate/phosphat... 82 3e-14 ref|XP_004167860.1| PREDICTED: probable sugar phosphate/phosphat... 80 2e-13 ref|XP_004150243.1| PREDICTED: probable sugar phosphate/phosphat... 80 2e-13 ref|XP_003538441.1| PREDICTED: probable sugar phosphate/phosphat... 80 2e-13 gb|ACU24623.1| unknown [Glycine max] 80 2e-13 >ref|XP_003544134.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320-like [Glycine max] Length = 306 Score = 82.4 bits (202), Expect = 3e-14 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +2 Query: 107 LKSSNRLFTIGLVASWYSSNIGVLLLNKYLLRNYGFKYPIFLT 235 +KSS+RLFTIGLV++WYSSNIGVLLLNKYLL NYGFKYPIFLT Sbjct: 1 MKSSSRLFTIGLVSAWYSSNIGVLLLNKYLLSNYGFKYPIFLT 43 >ref|XP_004167860.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320-like [Cucumis sativus] Length = 306 Score = 80.1 bits (196), Expect = 2e-13 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = +2 Query: 107 LKSSNRLFTIGLVASWYSSNIGVLLLNKYLLRNYGFKYPIFLT 235 +K S+R FTIGLV SWYSSNIGVLLLNKYLL NYGFKYPIFLT Sbjct: 1 MKGSSRFFTIGLVTSWYSSNIGVLLLNKYLLSNYGFKYPIFLT 43 >ref|XP_004150243.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320-like [Cucumis sativus] Length = 446 Score = 80.1 bits (196), Expect = 2e-13 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = +2 Query: 107 LKSSNRLFTIGLVASWYSSNIGVLLLNKYLLRNYGFKYPIFLT 235 +K S+R FTIGLV SWYSSNIGVLLLNKYLL NYGFKYPIFLT Sbjct: 141 MKGSSRFFTIGLVTSWYSSNIGVLLLNKYLLSNYGFKYPIFLT 183 >ref|XP_003538441.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g11320-like [Glycine max] Length = 307 Score = 79.7 bits (195), Expect = 2e-13 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +2 Query: 113 SSNRLFTIGLVASWYSSNIGVLLLNKYLLRNYGFKYPIFLT 235 S+NR FT+GLVA+WYSSNIGVLLLNKYLL NYGFKYPIFLT Sbjct: 4 SNNRFFTVGLVAAWYSSNIGVLLLNKYLLSNYGFKYPIFLT 44 >gb|ACU24623.1| unknown [Glycine max] Length = 307 Score = 79.7 bits (195), Expect = 2e-13 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +2 Query: 113 SSNRLFTIGLVASWYSSNIGVLLLNKYLLRNYGFKYPIFLT 235 S+NR FT+GLVA+WYSSNIGVLLLNKYLL NYGFKYPIFLT Sbjct: 4 SNNRFFTVGLVAAWYSSNIGVLLLNKYLLSNYGFKYPIFLT 44