BLASTX nr result
ID: Angelica22_contig00029341
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00029341 (379 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530585.1| nascent polypeptide associated complex alpha... 50 6e-07 >ref|XP_002530585.1| nascent polypeptide associated complex alpha subunit, putative [Ricinus communis] gi|223529884|gb|EEF31815.1| nascent polypeptide associated complex alpha subunit, putative [Ricinus communis] Length = 687 Score = 50.1 bits (118), Expect(2) = 6e-07 Identities = 23/48 (47%), Positives = 30/48 (62%) Frame = +2 Query: 47 LVKKRIAFRSIDTWEYYLGERCLRQLGFPCRVPTNPPQTMYESGKVAL 190 L +KRIAF +++WE Y+GER LRQ G R+P +PP Y G L Sbjct: 507 LSQKRIAFLGLESWELYMGERNLRQFGGGVRIPHSPPAERYGEGSQIL 554 Score = 28.1 bits (61), Expect(2) = 6e-07 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +1 Query: 211 GTSAENLVIER-LEYASWFATASVGRILNVNPYLGGLGTARKVLDDWRAKHR 363 G A +L+ ++ Y WF S+GRI++++ + G ++L+ W H+ Sbjct: 564 GVDAWDLLEDKEYSYVEWFRANSLGRIVDLDQFQGRKILGGRLLELWLRVHQ 615