BLASTX nr result
ID: Angelica22_contig00029323
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00029323 (342 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003605043.1| F-box/kelch-repeat protein [Medicago truncat... 66 3e-09 ref|XP_003605033.1| F-box/kelch-repeat protein [Medicago truncat... 65 4e-09 ref|XP_003623994.1| F-box protein [Medicago truncatula] gi|35549... 64 1e-08 ref|XP_003605042.1| F-box/kelch-repeat protein [Medicago truncat... 64 1e-08 ref|XP_003599496.1| F-box [Medicago truncatula] gi|355488544|gb|... 64 1e-08 >ref|XP_003605043.1| F-box/kelch-repeat protein [Medicago truncatula] gi|355506098|gb|AES87240.1| F-box/kelch-repeat protein [Medicago truncatula] Length = 418 Score = 66.2 bits (160), Expect = 3e-09 Identities = 33/88 (37%), Positives = 53/88 (60%) Frame = +3 Query: 66 TAKTLPAHLLLQVLYRTPVKSLVRFKCVCKSWLALLQHPTFIQLHLNFNTSRNGKQLICS 245 T+ LP HL++ +L R PVK L+RFKCVCKSW +L+ P F F T+ + +++I Sbjct: 6 TSVYLPHHLIILILLRLPVKYLIRFKCVCKSWFSLISDPHFANSQFQFTTATHTRRII-- 63 Query: 246 GGNGISHSHLVIALLSFSQDPVPVLNID 329 G + +SH I + ++ D +P N++ Sbjct: 64 GLSSLSHEIRSIDVDAWLNDDLPSPNLN 91 >ref|XP_003605033.1| F-box/kelch-repeat protein [Medicago truncatula] gi|355506088|gb|AES87230.1| F-box/kelch-repeat protein [Medicago truncatula] Length = 500 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/100 (32%), Positives = 53/100 (53%) Frame = +3 Query: 6 KPTKPQHHSNLPAAEDKNPITAKTLPAHLLLQVLYRTPVKSLVRFKCVCKSWLALLQHPT 185 K + + + + + ++K T LP L++Q+L R PVKSL+ FKCVCK W +L+ P Sbjct: 106 KAAQQRVYKMVESTQEKKQKTLPYLPHELIIQILMRLPVKSLIHFKCVCKLWFSLISDPH 165 Query: 186 FIQLHLNFNTSRNGKQLICSGGNGISHSHLVIALLSFSQD 305 F H T+ + +++C + +SH I +F D Sbjct: 166 FANSHFQLTTTTHTPRIMCI--SSLSHEIRSIGFEAFLND 203 >ref|XP_003623994.1| F-box protein [Medicago truncatula] gi|355499009|gb|AES80212.1| F-box protein [Medicago truncatula] Length = 249 Score = 64.3 bits (155), Expect = 1e-08 Identities = 34/92 (36%), Positives = 58/92 (63%) Frame = +3 Query: 63 ITAKTLPAHLLLQVLYRTPVKSLVRFKCVCKSWLALLQHPTFIQLHLNFNTSRNGKQLIC 242 +T LP L+ ++L PVKS VRFKCVCKSW L+ +P F++LHLN +++RN + Sbjct: 1 MTPVVLPDDLITELLSFLPVKSPVRFKCVCKSWKTLISNPNFVKLHLNQSSTRNPLFTLV 60 Query: 243 SGGNGISHSHLVIALLSFSQDPVPVLNIDKHF 338 + + + S + +L S ++P+ L++D ++ Sbjct: 61 T-LHFMGFSVVPYSLNSLIENPLFTLSVDPYY 91 >ref|XP_003605042.1| F-box/kelch-repeat protein [Medicago truncatula] gi|355506097|gb|AES87239.1| F-box/kelch-repeat protein [Medicago truncatula] Length = 357 Score = 64.3 bits (155), Expect = 1e-08 Identities = 32/88 (36%), Positives = 53/88 (60%) Frame = +3 Query: 66 TAKTLPAHLLLQVLYRTPVKSLVRFKCVCKSWLALLQHPTFIQLHLNFNTSRNGKQLICS 245 T+ LP L++ +L R PVK L+RFKCVCKSW +L+ P F + F T+ + +++I Sbjct: 6 TSVHLPHDLIILILLRLPVKYLIRFKCVCKSWFSLISEPHFAKSQFQFTTATHTRRII-- 63 Query: 246 GGNGISHSHLVIALLSFSQDPVPVLNID 329 G + +SH I + ++ D +P N++ Sbjct: 64 GLSSLSHEIRSIDVDAWLNDDLPSANLN 91 >ref|XP_003599496.1| F-box [Medicago truncatula] gi|355488544|gb|AES69747.1| F-box [Medicago truncatula] Length = 370 Score = 63.9 bits (154), Expect = 1e-08 Identities = 27/58 (46%), Positives = 39/58 (67%) Frame = +3 Query: 66 TAKTLPAHLLLQVLYRTPVKSLVRFKCVCKSWLALLQHPTFIQLHLNFNTSRNGKQLI 239 T LP L++Q+L R PVKSL+RFKCVCKSWL L+ P F + H + +T + +++ Sbjct: 5 TGLYLPHELIIQILLRLPVKSLIRFKCVCKSWLTLISDPHFAKSHFDLSTRTHTNRIV 62