BLASTX nr result
ID: Angelica22_contig00029186
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00029186 (687 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003516823.1| PREDICTED: uncharacterized protein LOC100806... 63 5e-08 gb|ADK38541.1| methylketone synthase IIa [Solanum lycopersicum] 62 1e-07 ref|NP_174759.1| thioesterase family protein [Arabidopsis thalia... 61 2e-07 ref|XP_002526988.1| acyl-CoA thioesterase, putative [Ricinus com... 59 7e-07 ref|XP_002893861.1| predicted protein [Arabidopsis lyrata subsp.... 59 9e-07 >ref|XP_003516823.1| PREDICTED: uncharacterized protein LOC100806931 [Glycine max] Length = 204 Score = 63.2 bits (152), Expect = 5e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 564 GMGGFHGIELKVRDYELDQYGVVNNAVYASY 656 GM GFH +ELKVRDYELDQYGVVNNAVYASY Sbjct: 64 GMSGFHDVELKVRDYELDQYGVVNNAVYASY 94 >gb|ADK38541.1| methylketone synthase IIa [Solanum lycopersicum] Length = 208 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/51 (64%), Positives = 37/51 (72%) Frame = +3 Query: 504 SLHKLQIFRAVHKIIPVLFLGMGGFHGIELKVRDYELDQYGVVNNAVYASY 656 S+ KL+ FRA H GM FH +ELKVRDYELDQYGVVNNA+YASY Sbjct: 48 SVSKLRSFRA-HAFDLKGSQGMAEFHEVELKVRDYELDQYGVVNNAIYASY 97 >ref|NP_174759.1| thioesterase family protein [Arabidopsis thaliana] gi|12322944|gb|AAG51460.1|AC069160_6 unknown protein [Arabidopsis thaliana] gi|89111888|gb|ABD60716.1| At1g35250 [Arabidopsis thaliana] gi|332193652|gb|AEE31773.1| thioesterase family protein [Arabidopsis thaliana] Length = 188 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 564 GMGGFHGIELKVRDYELDQYGVVNNAVYASY 656 G+GGFH IELKVRDYELDQ+GVVNNAVYA+Y Sbjct: 47 GIGGFHEIELKVRDYELDQFGVVNNAVYANY 77 >ref|XP_002526988.1| acyl-CoA thioesterase, putative [Ricinus communis] gi|223533623|gb|EEF35360.1| acyl-CoA thioesterase, putative [Ricinus communis] Length = 210 Score = 59.3 bits (142), Expect = 7e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 564 GMGGFHGIELKVRDYELDQYGVVNNAVYASY 656 GM F G+ELKVRDYELDQYGVVNNAVYASY Sbjct: 69 GMNSFVGVELKVRDYELDQYGVVNNAVYASY 99 >ref|XP_002893861.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297339703|gb|EFH70120.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 188 Score = 58.9 bits (141), Expect = 9e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 564 GMGGFHGIELKVRDYELDQYGVVNNAVYASY 656 G+ GFH IELKVRDYELDQ+GVVNNAVYA+Y Sbjct: 47 GISGFHEIELKVRDYELDQFGVVNNAVYANY 77