BLASTX nr result
ID: Angelica22_contig00029102
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00029102 (605 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002324414.1| predicted protein [Populus trichocarpa] gi|2... 70 4e-10 ref|XP_002331146.1| predicted protein [Populus trichocarpa] gi|2... 63 4e-08 ref|XP_002514322.1| conserved hypothetical protein [Ricinus comm... 62 1e-07 ref|XP_003629642.1| hypothetical protein MTR_8g083460 [Medicago ... 59 9e-07 >ref|XP_002324414.1| predicted protein [Populus trichocarpa] gi|222865848|gb|EEF02979.1| predicted protein [Populus trichocarpa] Length = 85 Score = 69.7 bits (169), Expect = 4e-10 Identities = 40/82 (48%), Positives = 50/82 (60%), Gaps = 4/82 (4%) Frame = -2 Query: 436 MCLAPSYLLPQGNLVVTRWHRHVLREATMVETRRPRLPTSMIPATDSS----KLKQCICS 269 MC P NLVV R R ++ +A VET PT + AT SS +K+C+CS Sbjct: 1 MCHPPGVPWVSRNLVVYR--RWLVLQA--VETETGHAPTE-VAATGSSAVAGSIKKCLCS 55 Query: 268 PTKHPGSFRCRHHHAEYVWGCR 203 PT+HPGSFRCRHH ++YVWG R Sbjct: 56 PTRHPGSFRCRHHRSDYVWGGR 77 >ref|XP_002331146.1| predicted protein [Populus trichocarpa] gi|222873229|gb|EEF10360.1| predicted protein [Populus trichocarpa] Length = 88 Score = 63.2 bits (152), Expect = 4e-08 Identities = 32/79 (40%), Positives = 46/79 (58%), Gaps = 1/79 (1%) Frame = -2 Query: 436 MCLAPSYLLPQGNLVVTRWHRHVLREATMVETRRPRLPTSMIPATDSSK-LKQCICSPTK 260 MC + Q NLVV + R ++ +A ET R + + S+ + +C+CSPT+ Sbjct: 1 MCHPGVLSVSQRNLVV--YQRRLVLQAVETETSHARTEVAAGGGSAISRSINKCLCSPTR 58 Query: 259 HPGSFRCRHHHAEYVWGCR 203 HPGSFRCRHH ++YVW R Sbjct: 59 HPGSFRCRHHRSDYVWSGR 77 >ref|XP_002514322.1| conserved hypothetical protein [Ricinus communis] gi|223546778|gb|EEF48276.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 61.6 bits (148), Expect = 1e-07 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = -2 Query: 289 LKQCICSPTKHPGSFRCRHHHAEYVWGCR 203 +K C+CSPT+HPGSFRCRHHH +Y WG R Sbjct: 58 IKMCVCSPTRHPGSFRCRHHHVDYAWGRR 86 >ref|XP_003629642.1| hypothetical protein MTR_8g083460 [Medicago truncatula] gi|357521031|ref|XP_003630804.1| hypothetical protein MTR_8g103600 [Medicago truncatula] gi|355523664|gb|AET04118.1| hypothetical protein MTR_8g083460 [Medicago truncatula] gi|355524826|gb|AET05280.1| hypothetical protein MTR_8g103600 [Medicago truncatula] Length = 83 Score = 58.5 bits (140), Expect = 9e-07 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = -2 Query: 307 ATDSSKLKQCICSPTKHPGSFRCRHHHAEYVWGCRKL 197 A + +KQC+CSP+KHPGSFRCR H A+YVW R + Sbjct: 46 AGEDGSIKQCVCSPSKHPGSFRCRQHQAKYVWRNRPI 82