BLASTX nr result
ID: Angelica22_contig00029027
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00029027 (236 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540643.1| PREDICTED: C2 domain-containing protein At1g... 156 2e-36 ref|XP_002316143.1| integral membrane single C2 domain protein [... 153 1e-35 ref|XP_002520602.1| conserved hypothetical protein [Ricinus comm... 152 2e-35 ref|XP_002312239.1| integral membrane single C2 domain protein [... 151 5e-35 ref|XP_004135352.1| PREDICTED: uncharacterized protein LOC101220... 151 6e-35 >ref|XP_003540643.1| PREDICTED: C2 domain-containing protein At1g53590-like [Glycine max] Length = 665 Score = 156 bits (394), Expect = 2e-36 Identities = 74/78 (94%), Positives = 76/78 (97%) Frame = +2 Query: 2 PVGIRDFDIDGELWVKLRLIPTEPWVGAAQWAFVSLPKINFELSPFRLFNLMAIPVLSMF 181 PVG+RDFDIDGELWVKLRLIPTEPWVGAA WAFVSLPKI FELSPFRLFNLMAIPVLSMF Sbjct: 291 PVGVRDFDIDGELWVKLRLIPTEPWVGAASWAFVSLPKIKFELSPFRLFNLMAIPVLSMF 350 Query: 182 LTKLLTEDLPRLFVRPKK 235 LTKLLTEDLP+LFVRPKK Sbjct: 351 LTKLLTEDLPKLFVRPKK 368 >ref|XP_002316143.1| integral membrane single C2 domain protein [Populus trichocarpa] gi|222865183|gb|EEF02314.1| integral membrane single C2 domain protein [Populus trichocarpa] Length = 669 Score = 153 bits (387), Expect = 1e-35 Identities = 73/78 (93%), Positives = 74/78 (94%) Frame = +2 Query: 2 PVGIRDFDIDGELWVKLRLIPTEPWVGAAQWAFVSLPKINFELSPFRLFNLMAIPVLSMF 181 PVG+RDFDIDGELWVKLRLIPTEPWVGA WAFVSLPKI FELSPFRLFNLMAIPVLSMF Sbjct: 298 PVGVRDFDIDGELWVKLRLIPTEPWVGAVSWAFVSLPKIKFELSPFRLFNLMAIPVLSMF 357 Query: 182 LTKLLTEDLPRLFVRPKK 235 L KLLTEDLPRLFVRPKK Sbjct: 358 LKKLLTEDLPRLFVRPKK 375 >ref|XP_002520602.1| conserved hypothetical protein [Ricinus communis] gi|223540201|gb|EEF41775.1| conserved hypothetical protein [Ricinus communis] Length = 671 Score = 152 bits (385), Expect = 2e-35 Identities = 73/78 (93%), Positives = 74/78 (94%) Frame = +2 Query: 2 PVGIRDFDIDGELWVKLRLIPTEPWVGAAQWAFVSLPKINFELSPFRLFNLMAIPVLSMF 181 PVGIRD DIDGELWVK+RLIPTEPWVGA WAFVSLPKI FELSPFRLFNLMAIPVLSMF Sbjct: 300 PVGIRDLDIDGELWVKVRLIPTEPWVGAVSWAFVSLPKIKFELSPFRLFNLMAIPVLSMF 359 Query: 182 LTKLLTEDLPRLFVRPKK 235 LTKLLTEDLPRLFVRPKK Sbjct: 360 LTKLLTEDLPRLFVRPKK 377 >ref|XP_002312239.1| integral membrane single C2 domain protein [Populus trichocarpa] gi|222852059|gb|EEE89606.1| integral membrane single C2 domain protein [Populus trichocarpa] Length = 657 Score = 151 bits (382), Expect = 5e-35 Identities = 72/78 (92%), Positives = 74/78 (94%) Frame = +2 Query: 2 PVGIRDFDIDGELWVKLRLIPTEPWVGAAQWAFVSLPKINFELSPFRLFNLMAIPVLSMF 181 PV +RDFDIDGELWVKLRLIPTEPWVGAA WAFVSLPKI FELSPFRLFNLMAIPVLS+F Sbjct: 296 PVSVRDFDIDGELWVKLRLIPTEPWVGAASWAFVSLPKIKFELSPFRLFNLMAIPVLSLF 355 Query: 182 LTKLLTEDLPRLFVRPKK 235 L KLLTEDLPRLFVRPKK Sbjct: 356 LKKLLTEDLPRLFVRPKK 373 >ref|XP_004135352.1| PREDICTED: uncharacterized protein LOC101220807 [Cucumis sativus] gi|449503295|ref|XP_004161931.1| PREDICTED: uncharacterized LOC101220807 [Cucumis sativus] Length = 674 Score = 151 bits (381), Expect = 6e-35 Identities = 72/78 (92%), Positives = 74/78 (94%) Frame = +2 Query: 2 PVGIRDFDIDGELWVKLRLIPTEPWVGAAQWAFVSLPKINFELSPFRLFNLMAIPVLSMF 181 PV +RDFDIDGELWVKLRLIPTEPWVGA WAFVSLPKI FELSPFRLFNLMAIPVLSMF Sbjct: 294 PVVVRDFDIDGELWVKLRLIPTEPWVGAVSWAFVSLPKIKFELSPFRLFNLMAIPVLSMF 353 Query: 182 LTKLLTEDLPRLFVRPKK 235 LTKLLTEDLP+LFVRPKK Sbjct: 354 LTKLLTEDLPKLFVRPKK 371