BLASTX nr result
ID: Angelica22_contig00028851
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00028851 (230 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530859.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002530859.1| conserved hypothetical protein [Ricinus communis] gi|223529583|gb|EEF31533.1| conserved hypothetical protein [Ricinus communis] Length = 229 Score = 54.7 bits (130), Expect = 8e-06 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -2 Query: 115 YQHPSHDQTSKISTNTSDFSFKPSSDVKGLRFGGQFIV 2 +QHP+ DQT+K TSDFSFKPSS+VKGLRFGGQFI+ Sbjct: 14 HQHPN-DQTTK---PTSDFSFKPSSEVKGLRFGGQFII 47