BLASTX nr result
ID: Angelica22_contig00028848
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00028848 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG01372.1| 21 kDa extracellular calmodulin-binding protein [... 112 3e-23 ref|XP_003523245.1| PREDICTED: citrate-binding protein-like [Gly... 59 5e-07 ref|XP_002298721.1| predicted protein [Populus trichocarpa] gi|2... 59 5e-07 ref|XP_003619176.1| Citrate-binding protein [Medicago truncatula... 58 9e-07 emb|CBI37638.3| unnamed protein product [Vitis vinifera] 57 1e-06 >gb|AAG01372.1| 21 kDa extracellular calmodulin-binding protein [Angelica dahurica] Length = 216 Score = 112 bits (280), Expect = 3e-23 Identities = 54/60 (90%), Positives = 57/60 (95%), Gaps = 1/60 (1%) Frame = -3 Query: 177 MKFAS-VLVPMYLCLLWLFFQQTLAVDPTVGFTSLPLDQSNFDIQRPYNVPVNKRYSFVN 1 MKFAS VLVPMYLCL+WLFF QT+AVDPTVGFTSLPLDQSN DIQRPYNVPV+KRYSFVN Sbjct: 1 MKFASAVLVPMYLCLVWLFFHQTMAVDPTVGFTSLPLDQSNLDIQRPYNVPVSKRYSFVN 60 >ref|XP_003523245.1| PREDICTED: citrate-binding protein-like [Glycine max] Length = 218 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -3 Query: 111 LAVDPTVGFTSLPLDQSNFDIQRPYNVPVNKRYSFVN 1 +A DPT GFT LPL SNF +QRPY+VPV++RYSF N Sbjct: 24 VAADPTYGFTRLPLSNSNFQVQRPYDVPVSQRYSFSN 60 >ref|XP_002298721.1| predicted protein [Populus trichocarpa] gi|222845979|gb|EEE83526.1| predicted protein [Populus trichocarpa] Length = 216 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/58 (48%), Positives = 41/58 (70%), Gaps = 2/58 (3%) Frame = -3 Query: 168 ASVLVPMYLCLLWLFFQQTLA--VDPTVGFTSLPLDQSNFDIQRPYNVPVNKRYSFVN 1 +S+++ LC + +Q + +DPT GFTSLPLDQSNF++Q PYN+ ++RYSF N Sbjct: 3 SSIVLLSLLCFSLISYQAIASRTMDPTKGFTSLPLDQSNFEVQWPYNMQEDQRYSFEN 60 >ref|XP_003619176.1| Citrate-binding protein [Medicago truncatula] gi|355494191|gb|AES75394.1| Citrate-binding protein [Medicago truncatula] Length = 217 Score = 57.8 bits (138), Expect = 9e-07 Identities = 21/34 (61%), Positives = 31/34 (91%) Frame = -3 Query: 102 DPTVGFTSLPLDQSNFDIQRPYNVPVNKRYSFVN 1 DPT GFTS+PL ++NF++Q+PYN+P+ KRYSF++ Sbjct: 28 DPTDGFTSVPLTEANFEVQKPYNIPIEKRYSFID 61 >emb|CBI37638.3| unnamed protein product [Vitis vinifera] Length = 308 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -3 Query: 105 VDPTVGFTSLPLDQSNFDIQRPYNVPVNKRYSFVN 1 +DPT GF SLPL+QSNF IQRPY+VP ++RYS+VN Sbjct: 28 IDPTEGFISLPLNQSNFVIQRPYDVPEDQRYSYVN 62