BLASTX nr result
ID: Angelica22_contig00028840
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00028840 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510642.1| conserved hypothetical protein [Ricinus comm... 59 3e-07 >ref|XP_002510642.1| conserved hypothetical protein [Ricinus communis] gi|223551343|gb|EEF52829.1| conserved hypothetical protein [Ricinus communis] Length = 230 Score = 59.3 bits (142), Expect = 3e-07 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 3/50 (6%) Frame = +2 Query: 173 SRPNFGALRELQDSANHLLHSPTTKRALV---QDKYVDEVCEASLQMLDI 313 S P+F AL EL +SAN+LLHSP +R LV Q+K+V EVC+ASL+MLD+ Sbjct: 2 SLPDFNALTELHNSANNLLHSPEIQRVLVHQKQEKWVQEVCDASLRMLDV 51