BLASTX nr result
ID: Angelica22_contig00028827
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00028827 (231 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC42409.1| putative osmosensor histidine Kinase [Populus x ... 76 3e-12 ref|XP_002337182.1| histidine kinase osmosensor protein [Populus... 75 6e-12 gb|AAQ10680.2| cold inducible histidine kinase 1 [Catharanthus r... 74 1e-11 emb|CAI78447.1| osmosensor histidine-aspartate kinase [Populus x... 74 1e-11 ref|XP_003548838.1| PREDICTED: histidine kinase 1-like [Glycine ... 74 1e-11 >emb|CAC42409.1| putative osmosensor histidine Kinase [Populus x canadensis] Length = 331 Score = 76.3 bits (186), Expect = 3e-12 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +3 Query: 3 DPRKWDSVFESFEQADPSTTRLHGGTGPGLCIARTLASK 119 DPRKW+SVFESFEQADPSTTRLHGGTG GLCI RTL +K Sbjct: 193 DPRKWESVFESFEQADPSTTRLHGGTGLGLCIVRTLVNK 231 >ref|XP_002337182.1| histidine kinase osmosensor protein [Populus trichocarpa] gi|222838420|gb|EEE76785.1| histidine kinase osmosensor protein [Populus trichocarpa] Length = 318 Score = 75.1 bits (183), Expect = 6e-12 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +3 Query: 3 DPRKWDSVFESFEQADPSTTRLHGGTGPGLCIARTLASK 119 DP KW+SVFESFEQADPSTTRLHGGTG GLCI RTL SK Sbjct: 265 DPSKWESVFESFEQADPSTTRLHGGTGLGLCIVRTLVSK 303 >gb|AAQ10680.2| cold inducible histidine kinase 1 [Catharanthus roseus] Length = 1205 Score = 73.9 bits (180), Expect = 1e-11 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 DPRKWDSVFESFEQADPSTTRLHGGTGPGLCIARTLASK 119 DP KW+SVFESFEQADPSTTRLHGGTG GLCI RTL +K Sbjct: 693 DPSKWESVFESFEQADPSTTRLHGGTGLGLCIVRTLVNK 731 >emb|CAI78447.1| osmosensor histidine-aspartate kinase [Populus x canadensis] Length = 1249 Score = 73.9 bits (180), Expect = 1e-11 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 DPRKWDSVFESFEQADPSTTRLHGGTGPGLCIARTLASK 119 DP KW+SVFESFEQADPSTTRLHGGTG GLCI RTL +K Sbjct: 706 DPSKWESVFESFEQADPSTTRLHGGTGLGLCIVRTLVNK 744 >ref|XP_003548838.1| PREDICTED: histidine kinase 1-like [Glycine max] Length = 1197 Score = 73.9 bits (180), Expect = 1e-11 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 DPRKWDSVFESFEQADPSTTRLHGGTGPGLCIARTLASK 119 DP KW+SVFESFEQADPSTTRLHGGTG GLCI RTL +K Sbjct: 685 DPSKWESVFESFEQADPSTTRLHGGTGLGLCIVRTLVNK 723