BLASTX nr result
ID: Angelica22_contig00028538
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00028538 (530 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272722.2| PREDICTED: uncharacterized protein LOC100264... 69 5e-11 ref|XP_002511838.1| synaptotagmin, putative [Ricinus communis] g... 69 7e-11 ref|XP_003538346.1| PREDICTED: uncharacterized protein LOC100777... 68 9e-11 ref|XP_002509788.1| synaptotagmin, putative [Ricinus communis] g... 67 2e-10 ref|NP_001168012.1| uncharacterized protein LOC100381735 [Zea ma... 66 3e-10 >ref|XP_002272722.2| PREDICTED: uncharacterized protein LOC100264973 [Vitis vinifera] Length = 988 Score = 68.9 bits (167), Expect(2) = 5e-11 Identities = 34/63 (53%), Positives = 42/63 (66%) Frame = -2 Query: 487 FSLVLVFCGLFVVDKWFGQVCIARNHVTAMQVHSLF*CLCVLQELILPTVFLFIFLIEL* 308 F L+ +F GLF V KWFG +C+ RN +T + VH LF L ELILPTVFL++FLI Sbjct: 787 FRLMSIFSGLFAVGKWFGDICMWRNPITTVLVHVLFLMLVCFPELILPTVFLYMFLI--- 843 Query: 307 GSW 299 G W Sbjct: 844 GVW 846 Score = 23.1 bits (48), Expect(2) = 5e-11 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 528 ESHLRSVRQSNTNFF 484 +SHL S+R+S NFF Sbjct: 773 DSHLWSMRRSKANFF 787 >ref|XP_002511838.1| synaptotagmin, putative [Ricinus communis] gi|223549018|gb|EEF50507.1| synaptotagmin, putative [Ricinus communis] Length = 1017 Score = 68.6 bits (166), Expect(2) = 7e-11 Identities = 35/63 (55%), Positives = 43/63 (68%) Frame = -2 Query: 487 FSLVLVFCGLFVVDKWFGQVCIARNHVTAMQVHSLF*CLCVLQELILPTVFLFIFLIEL* 308 F L+ VF GLF V KWFG+VC+ +N +T + VH LF L ELILPTVFL++FLI Sbjct: 816 FRLMSVFSGLFSVGKWFGEVCMWKNPITTVLVHLLFVMLVCFPELILPTVFLYMFLI--- 872 Query: 307 GSW 299 G W Sbjct: 873 GFW 875 Score = 23.1 bits (48), Expect(2) = 7e-11 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 528 ESHLRSVRQSNTNFF 484 +SHL S+R+S NFF Sbjct: 802 DSHLWSMRRSKANFF 816 >ref|XP_003538346.1| PREDICTED: uncharacterized protein LOC100777951 [Glycine max] Length = 1006 Score = 68.2 bits (165), Expect(2) = 9e-11 Identities = 33/63 (52%), Positives = 42/63 (66%) Frame = -2 Query: 487 FSLVLVFCGLFVVDKWFGQVCIARNHVTAMQVHSLF*CLCVLQELILPTVFLFIFLIEL* 308 F L+ VF G+F V KWFG +C+ RN +T + VH LF L ELILPT+FL++FLI Sbjct: 805 FRLMTVFSGVFAVGKWFGDICMWRNPITTVLVHVLFLMLVCFPELILPTIFLYMFLI--- 861 Query: 307 GSW 299 G W Sbjct: 862 GVW 864 Score = 23.1 bits (48), Expect(2) = 9e-11 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 528 ESHLRSVRQSNTNFF 484 +SHL S+R+S NFF Sbjct: 791 DSHLWSMRRSKANFF 805 >ref|XP_002509788.1| synaptotagmin, putative [Ricinus communis] gi|223549687|gb|EEF51175.1| synaptotagmin, putative [Ricinus communis] Length = 980 Score = 67.4 bits (163), Expect(2) = 2e-10 Identities = 33/63 (52%), Positives = 41/63 (65%) Frame = -2 Query: 487 FSLVLVFCGLFVVDKWFGQVCIARNHVTAMQVHSLF*CLCVLQELILPTVFLFIFLIEL* 308 F L+ VF GLF KWFG +C+ RN +T + VH L+ L ELILPTVFL++FLI Sbjct: 779 FRLMTVFSGLFAAGKWFGDICMWRNPITTVLVHVLYLMLACFPELILPTVFLYMFLI--- 835 Query: 307 GSW 299 G W Sbjct: 836 GVW 838 Score = 23.1 bits (48), Expect(2) = 2e-10 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 528 ESHLRSVRQSNTNFF 484 +SHL S+R+S NFF Sbjct: 765 DSHLWSMRRSKANFF 779 >ref|NP_001168012.1| uncharacterized protein LOC100381735 [Zea mays] gi|223945493|gb|ACN26830.1| unknown [Zea mays] gi|414584713|tpg|DAA35284.1| TPA: hypothetical protein ZEAMMB73_455623 [Zea mays] gi|414584714|tpg|DAA35285.1| TPA: hypothetical protein ZEAMMB73_455623 [Zea mays] Length = 1012 Score = 66.2 bits (160), Expect(2) = 3e-10 Identities = 35/63 (55%), Positives = 40/63 (63%) Frame = -2 Query: 487 FSLVLVFCGLFVVDKWFGQVCIARNHVTAMQVHSLF*CLCVLQELILPTVFLFIFLIEL* 308 F L+ VF GLF V KWF VC RN +T + VH LF L ELILPTVFL++FLI Sbjct: 811 FRLMTVFSGLFAVSKWFSGVCSWRNPITTVLVHILFIMLVCFPELILPTVFLYMFLI--- 867 Query: 307 GSW 299 G W Sbjct: 868 GIW 870 Score = 23.1 bits (48), Expect(2) = 3e-10 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 528 ESHLRSVRQSNTNFF 484 +SHL S+R+S NFF Sbjct: 797 DSHLWSMRKSKANFF 811