BLASTX nr result
ID: Angelica22_contig00028350
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00028350 (398 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534454.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002534454.1| conserved hypothetical protein [Ricinus communis] gi|223525258|gb|EEF27929.1| conserved hypothetical protein [Ricinus communis] Length = 110 Score = 54.7 bits (130), Expect = 8e-06 Identities = 35/96 (36%), Positives = 53/96 (55%) Frame = -2 Query: 397 LRRRLKKGQSFFPLNALPVSGYLEHEVPKNEHEVPREYSPVKHASSSQDTECQTEAENGE 218 LRR++++ + FFP + YLE+ + V R++S + + S+S + C E G+ Sbjct: 21 LRRQVEELRGFFPSTDHSIPTYLEY------YSVDRKHSLINNGSASPEIACNCSMEKGD 74 Query: 217 LMTTLFLGPPPDNGQRKRKTPERETETPSGTSGSQI 110 TTL LG P D RKRK P + E+PS S SQ+ Sbjct: 75 SDTTLHLGLPTD-AYRKRKAP--QGESPSNDSESQL 107