BLASTX nr result
ID: Angelica22_contig00028241
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00028241 (1449 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278014.2| PREDICTED: pentatricopeptide repeat-containi... 67 1e-08 ref|XP_004157939.1| PREDICTED: pentatricopeptide repeat-containi... 63 2e-07 ref|XP_004141071.1| PREDICTED: pentatricopeptide repeat-containi... 63 2e-07 ref|XP_003523536.1| PREDICTED: pentatricopeptide repeat-containi... 58 5e-06 ref|XP_002885810.1| pentatricopeptide repeat-containing protein ... 58 5e-06 >ref|XP_002278014.2| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Vitis vinifera] Length = 641 Score = 67.0 bits (162), Expect = 1e-08 Identities = 35/83 (42%), Positives = 52/83 (62%), Gaps = 1/83 (1%) Frame = +2 Query: 254 MCKVREPNKAFLLLN-MEYFGCLPYVRSYNILIKGFCRIGNVIRAYMSFEEK*SDKIASR 430 +C++ + +KAF L N M FGC P V +YN LI GFCR+ V R + +E S S Sbjct: 247 LCRIGKVDKAFELFNEMRGFGCSPDVITYNTLINGFCRVNEVDRGHDLLKELLSKNDLSP 306 Query: 431 WMLLHTSVV*GYCRLDEMEKAGM 499 ++ +TS++ GYC+L +MEKA + Sbjct: 307 DVVTYTSIISGYCKLGKMEKASI 329 >ref|XP_004157939.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Cucumis sativus] Length = 548 Score = 62.8 bits (151), Expect = 2e-07 Identities = 31/81 (38%), Positives = 49/81 (60%), Gaps = 1/81 (1%) Frame = +2 Query: 254 MCKVREPNKAF-LLLNMEYFGCLPYVRSYNILIKGFCRIGNVIRAYMSFEEK*SDKIASR 430 +C++ E +KAF NM FGC P + SYN LI GFCR+ + + + +E K S Sbjct: 224 LCRIGEIDKAFEFFQNMGNFGCFPDIVSYNTLINGFCRVNEISKGHDLLKEDMLIKGVSP 283 Query: 431 WMLLHTSVV*GYCRLDEMEKA 493 ++ +TS++ GYC+L +M+ A Sbjct: 284 DVITYTSIISGYCKLGDMKAA 304 >ref|XP_004141071.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Cucumis sativus] Length = 548 Score = 62.8 bits (151), Expect = 2e-07 Identities = 31/81 (38%), Positives = 49/81 (60%), Gaps = 1/81 (1%) Frame = +2 Query: 254 MCKVREPNKAF-LLLNMEYFGCLPYVRSYNILIKGFCRIGNVIRAYMSFEEK*SDKIASR 430 +C++ E +KAF NM FGC P + SYN LI GFCR+ + + + +E K S Sbjct: 224 LCRIGEIDKAFEFFQNMGNFGCFPDIVSYNTLINGFCRVNEISKGHDLLKEDMLIKGVSP 283 Query: 431 WMLLHTSVV*GYCRLDEMEKA 493 ++ +TS++ GYC+L +M+ A Sbjct: 284 DVITYTSIISGYCKLGDMKAA 304 >ref|XP_003523536.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Glycine max] Length = 598 Score = 58.2 bits (139), Expect = 5e-06 Identities = 31/83 (37%), Positives = 50/83 (60%), Gaps = 1/83 (1%) Frame = +2 Query: 254 MCKVREPNKAFLLLN-MEYFGCLPYVRSYNILIKGFCRIGNVIRAYMSFEEK*SDKIASR 430 +C+ E ++AF LLN + FGCLP V +YN LI G CRI V RA +E + + Sbjct: 186 LCRAGEIDEAFRLLNDLRSFGCLPDVITYNTLIHGLCRINEVDRARSLLKEVCLNGEFAP 245 Query: 431 WMLLHTSVV*GYCRLDEMEKAGM 499 ++ +T+++ GYC+ +ME+ + Sbjct: 246 DVVSYTTIISGYCKFSKMEEGNL 268 >ref|XP_002885810.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297331650|gb|EFH62069.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 536 Score = 58.2 bits (139), Expect = 5e-06 Identities = 31/83 (37%), Positives = 50/83 (60%), Gaps = 1/83 (1%) Frame = +2 Query: 254 MCKVREPNKAFLLLN-MEYFGCLPYVRSYNILIKGFCRIGNVIRAYMSFEEK*SDKIASR 430 +C V + KA LL M FGCLP + +YN LIKGFC+ + +A F++ S S Sbjct: 216 LCGVGKAEKAVELLGGMSGFGCLPDIVTYNTLIKGFCKSNELKKANEMFDDVKSSSGCSP 275 Query: 431 WMLLHTSVV*GYCRLDEMEKAGM 499 ++ +TS++ GYC+ +M++A + Sbjct: 276 DVVTYTSMISGYCKAGKMQEASV 298