BLASTX nr result
ID: Angelica22_contig00028231
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00028231 (374 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI27683.3| unnamed protein product [Vitis vinifera] 72 4e-11 ref|XP_002514886.1| conserved hypothetical protein [Ricinus comm... 68 7e-10 ref|XP_002271512.1| PREDICTED: uncharacterized protein LOC100266... 62 6e-08 emb|CAN72196.1| hypothetical protein VITISV_014980 [Vitis vinifera] 62 6e-08 ref|XP_002299323.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 >emb|CBI27683.3| unnamed protein product [Vitis vinifera] Length = 381 Score = 72.4 bits (176), Expect = 4e-11 Identities = 35/53 (66%), Positives = 41/53 (77%) Frame = +1 Query: 1 DIVIYPQRALSKKGTSSCKSHLYPPQGTLNASDSDGNREHWIKTDADYLVLEL 159 DI+I+PQR LSK+ KS PPQ TL +DS+GNRE+WIKTDADYLVLEL Sbjct: 329 DIMIFPQRTLSKESIRRYKSQSNPPQFTLCGNDSNGNREYWIKTDADYLVLEL 381 >ref|XP_002514886.1| conserved hypothetical protein [Ricinus communis] gi|223545937|gb|EEF47440.1| conserved hypothetical protein [Ricinus communis] Length = 388 Score = 68.2 bits (165), Expect = 7e-10 Identities = 33/53 (62%), Positives = 41/53 (77%) Frame = +1 Query: 1 DIVIYPQRALSKKGTSSCKSHLYPPQGTLNASDSDGNREHWIKTDADYLVLEL 159 +I + PQRALSK+ KS PPQ TL++S+S+G+RE WIKTDADYLVLEL Sbjct: 336 EITVLPQRALSKRSIRRYKSQSNPPQFTLSSSESNGSRECWIKTDADYLVLEL 388 >ref|XP_002271512.1| PREDICTED: uncharacterized protein LOC100266157 [Vitis vinifera] Length = 428 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = +1 Query: 1 DIVIYPQRALSKKGTSSCKSHLYPPQGTLNASDSDGNREHWIKTDAD 141 DI+I+PQR LSK+ KS PPQ TL +DS+GNRE+WIKTDAD Sbjct: 365 DIMIFPQRTLSKESIRRYKSQSNPPQFTLCGNDSNGNREYWIKTDAD 411 >emb|CAN72196.1| hypothetical protein VITISV_014980 [Vitis vinifera] Length = 458 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = +1 Query: 1 DIVIYPQRALSKKGTSSCKSHLYPPQGTLNASDSDGNREHWIKTDAD 141 DI+I+PQR LSK+ KS PPQ TL +DS+GNRE+WIKTDAD Sbjct: 395 DIMIFPQRTLSKESIRRYKSQSNPPQFTLCGNDSNGNREYWIKTDAD 441 >ref|XP_002299323.1| predicted protein [Populus trichocarpa] gi|222846581|gb|EEE84128.1| predicted protein [Populus trichocarpa] Length = 384 Score = 55.1 bits (131), Expect = 6e-06 Identities = 30/53 (56%), Positives = 33/53 (62%) Frame = +1 Query: 1 DIVIYPQRALSKKGTSSCKSHLYPPQGTLNASDSDGNREHWIKTDADYLVLEL 159 DI I P R LSK+ KS PP DS+G+RE WIKTDADYLVLEL Sbjct: 333 DITIVP-RTLSKRSIRRFKSQSNPPHFMFTGCDSNGSRECWIKTDADYLVLEL 384