BLASTX nr result
ID: Angelica22_contig00027510
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00027510 (386 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528440.1| Disease resistance protein RPP8, putative [R... 61 8e-08 ref|XP_002529494.1| conserved hypothetical protein [Ricinus comm... 55 5e-06 >ref|XP_002528440.1| Disease resistance protein RPP8, putative [Ricinus communis] gi|223532116|gb|EEF33923.1| Disease resistance protein RPP8, putative [Ricinus communis] Length = 920 Score = 61.2 bits (147), Expect = 8e-08 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 1/71 (1%) Frame = +2 Query: 2 LPNLTNLHFN-DVYNGSKMVCTDDAFQSLQIFKLQYIPHVNEWQFEDGAMPSLRFFTISD 178 LPNLT LH D YNGSKMVC+ + F L+I ++ + + EW+ +GAMPSLR I + Sbjct: 804 LPNLTFLHLGEDSYNGSKMVCSVNGFPCLEILEITGLD-LQEWEVTEGAMPSLRMLYIRN 862 Query: 179 HPCLNIVPPRL 211 P L ++P L Sbjct: 863 LPRLKMIPEGL 873 >ref|XP_002529494.1| conserved hypothetical protein [Ricinus communis] gi|223531052|gb|EEF32904.1| conserved hypothetical protein [Ricinus communis] Length = 1115 Score = 55.5 bits (132), Expect = 5e-06 Identities = 30/71 (42%), Positives = 39/71 (54%), Gaps = 1/71 (1%) Frame = +2 Query: 2 LPNLTNLH-FNDVYNGSKMVCTDDAFQSLQIFKLQYIPHVNEWQFEDGAMPSLRFFTISD 178 LPNL NL F + G KMVCT AF L++ KL + + EW E+GAMP L+ I Sbjct: 1003 LPNLINLRLFCGSFTGQKMVCTSRAFPKLRVLKLWELDPLEEWNIEEGAMPGLKCLEIRS 1062 Query: 179 HPCLNIVPPRL 211 L ++P L Sbjct: 1063 CRNLGMLPDGL 1073