BLASTX nr result
ID: Angelica22_contig00027377
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00027377 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003517920.1| PREDICTED: B3 domain-containing transcriptio... 68 9e-10 emb|CAN72783.1| hypothetical protein VITISV_008016 [Vitis vinifera] 68 9e-10 ref|XP_003548489.1| PREDICTED: B3 domain-containing transcriptio... 67 1e-09 ref|XP_003551329.1| PREDICTED: putative B3 domain-containing pro... 67 2e-09 ref|XP_002281517.1| PREDICTED: B3 domain-containing transcriptio... 67 2e-09 >ref|XP_003517920.1| PREDICTED: B3 domain-containing transcription factor VRN1-like [Glycine max] Length = 318 Score = 67.8 bits (164), Expect = 9e-10 Identities = 29/73 (39%), Positives = 46/73 (63%) Frame = +3 Query: 45 KQTRFFKIIPSGIGSHTQLMVPTKFADVHGNDLNDRVSLEVPNGLVWSVDLERRANRIWL 224 K+ FF+II + +LM+P KF + +G L + + L+ PNG W + LE+R +++W Sbjct: 12 KKMHFFRIIIAPSLQEGKLMLPNKFVEKYGEGLPNTLFLKAPNGAEWKLTLEKRDDKMWF 71 Query: 225 QNGWPEFANHYSI 263 Q GW EFA H+S+ Sbjct: 72 QKGWREFAKHHSL 84 >emb|CAN72783.1| hypothetical protein VITISV_008016 [Vitis vinifera] Length = 749 Score = 67.8 bits (164), Expect = 9e-10 Identities = 33/79 (41%), Positives = 47/79 (59%) Frame = +3 Query: 27 PSGSTAKQTRFFKIIPSGIGSHTQLMVPTKFADVHGNDLNDRVSLEVPNGLVWSVDLERR 206 PS +A + FFKII S I L +P +F +G +L++ + L+VP+G VW V L+R Sbjct: 15 PSTISATRPHFFKIIHSTILRDGTLGIPKRFVSRYGKNLSNIMFLKVPSGAVWQVGLKRG 74 Query: 207 ANRIWLQNGWPEFANHYSI 263 +WL GW EF +YSI Sbjct: 75 DGEVWLDGGWREFVEYYSI 93 >ref|XP_003548489.1| PREDICTED: B3 domain-containing transcription factor VRN1-like [Glycine max] Length = 363 Score = 67.4 bits (163), Expect = 1e-09 Identities = 31/82 (37%), Positives = 47/82 (57%) Frame = +3 Query: 18 ASSPSGSTAKQTRFFKIIPSGIGSHTQLMVPTKFADVHGNDLNDRVSLEVPNGLVWSVDL 197 A+ P K FFKII + +LM+P KF + +G L + + L+ PNG W+ +L Sbjct: 4 ATFPHQLQVKPFHFFKIITAQNLQDGKLMIPNKFVEKYGEGLPNALFLKTPNGTEWNFNL 63 Query: 198 ERRANRIWLQNGWPEFANHYSI 263 E+ +IW Q GW EFA ++S+ Sbjct: 64 EKHDGKIWFQKGWKEFAEYHSL 85 >ref|XP_003551329.1| PREDICTED: putative B3 domain-containing protein Os03g0621600-like [Glycine max] Length = 344 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/82 (37%), Positives = 46/82 (56%) Frame = +3 Query: 18 ASSPSGSTAKQTRFFKIIPSGIGSHTQLMVPTKFADVHGNDLNDRVSLEVPNGLVWSVDL 197 A+ P K FFKII + +LM+P KF +G L + + L+ PNG W + L Sbjct: 3 ATFPQQLLVKPIHFFKIITAHNVHEGKLMIPNKFVKKYGKRLQNTLFLKTPNGAEWKMIL 62 Query: 198 ERRANRIWLQNGWPEFANHYSI 263 ++R +IW Q GW EFA ++S+ Sbjct: 63 KKRDGKIWFQKGWKEFAEYHSL 84 >ref|XP_002281517.1| PREDICTED: B3 domain-containing transcription factor VRN1-like [Vitis vinifera] Length = 407 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/80 (37%), Positives = 44/80 (55%) Frame = +3 Query: 27 PSGSTAKQTRFFKIIPSGIGSHTQLMVPTKFADVHGNDLNDRVSLEVPNGLVWSVDLERR 206 PS + F+K+I S + +L +P KF G+ L+ +L +PNG VW V L + Sbjct: 15 PSSQPTRSLLFYKLIVSSVLQAKRLRIPQKFVKKSGDQLSAVTTLTLPNGGVWYVGLTKA 74 Query: 207 ANRIWLQNGWPEFANHYSIH 266 N+ W +GW EF +YSIH Sbjct: 75 DNKFWFYHGWHEFVEYYSIH 94