BLASTX nr result
ID: Angelica22_contig00027042
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00027042 (402 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003544903.1| PREDICTED: mitochondrial RNA-splicing protei... 57 2e-06 ref|XP_002516353.1| mitochondrial carrier protein, putative [Ric... 55 6e-06 >ref|XP_003544903.1| PREDICTED: mitochondrial RNA-splicing protein MRS3-like [Glycine max] Length = 324 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -3 Query: 400 FHAPAAAICWSTYEAGKAFFQDVNCSSNISKVT 302 FHAPAAAICWSTYEAGK+FFQD N +I VT Sbjct: 292 FHAPAAAICWSTYEAGKSFFQDFNQQKDIGTVT 324 >ref|XP_002516353.1| mitochondrial carrier protein, putative [Ricinus communis] gi|223544519|gb|EEF46037.1| mitochondrial carrier protein, putative [Ricinus communis] Length = 326 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -3 Query: 400 FHAPAAAICWSTYEAGKAFFQDVNCSSNISKVT 302 FHAPAAAICWSTYEA K FFQ++N +SN VT Sbjct: 294 FHAPAAAICWSTYEAAKVFFQELNDNSNSGTVT 326