BLASTX nr result
ID: Angelica22_contig00027041
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00027041 (347 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529764.1| kinase, putative [Ricinus communis] gi|22353... 65 8e-09 ref|XP_002529762.1| receptor serine/threonine kinase, putative [... 65 8e-09 ref|XP_002263106.2| PREDICTED: probable receptor-like protein ki... 64 1e-08 ref|XP_002268775.1| PREDICTED: probable receptor-like protein ki... 62 5e-08 ref|XP_002267723.1| PREDICTED: probable receptor-like protein ki... 62 6e-08 >ref|XP_002529764.1| kinase, putative [Ricinus communis] gi|223530762|gb|EEF32630.1| kinase, putative [Ricinus communis] Length = 646 Score = 64.7 bits (156), Expect = 8e-09 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = +3 Query: 3 MWCIQMNPTERPSMHEVIGMLEGDLKLLVMPPKPLICPEEVRTRGDD 143 +WCIQM P+ RP M+EVI MLEGDL+ L +PP+P I PEEV G++ Sbjct: 581 LWCIQMKPSNRPPMNEVIEMLEGDLESLQLPPRPFIYPEEVINDGEE 627 >ref|XP_002529762.1| receptor serine/threonine kinase, putative [Ricinus communis] gi|223530760|gb|EEF32628.1| receptor serine/threonine kinase, putative [Ricinus communis] Length = 348 Score = 64.7 bits (156), Expect = 8e-09 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = +3 Query: 3 MWCIQMNPTERPSMHEVIGMLEGDLKLLVMPPKPLICPEEVRTRGD 140 +WCIQM P +RP M++VI MLEGDL+ L +PP+PL+ PEE RG+ Sbjct: 274 LWCIQMEPNDRPPMNKVIEMLEGDLESLQLPPRPLLYPEETLRRGE 319 >ref|XP_002263106.2| PREDICTED: probable receptor-like protein kinase At1g67000-like [Vitis vinifera] Length = 603 Score = 63.9 bits (154), Expect = 1e-08 Identities = 25/41 (60%), Positives = 37/41 (90%) Frame = +3 Query: 3 MWCIQMNPTERPSMHEVIGMLEGDLKLLVMPPKPLICPEEV 125 +WCIQ+ P++RPSM++V+ MLEG+++LL MPPKPL+ P+EV Sbjct: 544 LWCIQLKPSDRPSMNKVVEMLEGNVELLQMPPKPLLTPQEV 584 >ref|XP_002268775.1| PREDICTED: probable receptor-like protein kinase At1g67000-like [Vitis vinifera] Length = 608 Score = 62.0 bits (149), Expect = 5e-08 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = +3 Query: 3 MWCIQMNPTERPSMHEVIGMLEGDLKLLVMPPKPLICPEEVRT 131 +WCIQ+ P++RPSM +VI MLEG++ LL MPPKP + P+EV T Sbjct: 549 LWCIQLKPSDRPSMQKVIEMLEGNVDLLQMPPKPSLTPQEVPT 591 >ref|XP_002267723.1| PREDICTED: probable receptor-like protein kinase At1g67000-like [Vitis vinifera] Length = 598 Score = 61.6 bits (148), Expect = 6e-08 Identities = 24/41 (58%), Positives = 35/41 (85%) Frame = +3 Query: 3 MWCIQMNPTERPSMHEVIGMLEGDLKLLVMPPKPLICPEEV 125 +WCIQ+ P++RPSM +V+ MLEG+++LL MPPKP + P+EV Sbjct: 553 LWCIQLKPSDRPSMSKVVEMLEGNVELLQMPPKPFLTPQEV 593