BLASTX nr result
ID: Angelica22_contig00026913
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00026913 (396 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002871697.1| nsp-interacting kinase 1 [Arabidopsis lyrata... 82 3e-14 ref|NP_179973.2| putative LRR receptor-like serine/threonine-pro... 81 8e-14 ref|XP_002880534.1| leucine-rich repeat family protein [Arabidop... 81 8e-14 gb|ADG39068.1| AT5G16000-like protein [Neslia paniculata] 81 8e-14 gb|AAC63680.1| putative LRR receptor protein kinase [Arabidopsis... 81 8e-14 >ref|XP_002871697.1| nsp-interacting kinase 1 [Arabidopsis lyrata subsp. lyrata] gi|297317534|gb|EFH47956.1| nsp-interacting kinase 1 [Arabidopsis lyrata subsp. lyrata] Length = 638 Score = 82.4 bits (202), Expect = 3e-14 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -3 Query: 394 DFGLAKFLNHQDSHVTTAVRGTVGHIAPEYLSTGQSSEKT 275 DFGLAK LNHQDSHVTTAVRGTVGHIAPEYLSTGQSSEKT Sbjct: 453 DFGLAKLLNHQDSHVTTAVRGTVGHIAPEYLSTGQSSEKT 492 >ref|NP_179973.2| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] gi|122223928|sp|Q0WVM4.1|Y2239_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein kinase At2g23950; Flags: Precursor gi|110741758|dbj|BAE98824.1| putative LRR receptor protein kinase [Arabidopsis thaliana] gi|224589519|gb|ACN59293.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] gi|330252413|gb|AEC07507.1| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] Length = 634 Score = 81.3 bits (199), Expect = 8e-14 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -3 Query: 394 DFGLAKFLNHQDSHVTTAVRGTVGHIAPEYLSTGQSSEKT 275 DFGLAK LNH+DSHVTTAVRGTVGHIAPEYLSTGQSSEKT Sbjct: 440 DFGLAKLLNHEDSHVTTAVRGTVGHIAPEYLSTGQSSEKT 479 >ref|XP_002880534.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297326373|gb|EFH56793.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Length = 641 Score = 81.3 bits (199), Expect = 8e-14 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -3 Query: 394 DFGLAKFLNHQDSHVTTAVRGTVGHIAPEYLSTGQSSEKT 275 DFGLAK LNH+DSHVTTAVRGTVGHIAPEYLSTGQSSEKT Sbjct: 445 DFGLAKLLNHEDSHVTTAVRGTVGHIAPEYLSTGQSSEKT 484 >gb|ADG39068.1| AT5G16000-like protein [Neslia paniculata] Length = 178 Score = 81.3 bits (199), Expect = 8e-14 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -3 Query: 394 DFGLAKFLNHQDSHVTTAVRGTVGHIAPEYLSTGQSSEKT 275 DFGLAK LNHQD+HVTTAVRGTVGHIAPEYLSTGQSSEKT Sbjct: 12 DFGLAKLLNHQDTHVTTAVRGTVGHIAPEYLSTGQSSEKT 51 >gb|AAC63680.1| putative LRR receptor protein kinase [Arabidopsis thaliana] Length = 607 Score = 81.3 bits (199), Expect = 8e-14 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -3 Query: 394 DFGLAKFLNHQDSHVTTAVRGTVGHIAPEYLSTGQSSEKT 275 DFGLAK LNH+DSHVTTAVRGTVGHIAPEYLSTGQSSEKT Sbjct: 413 DFGLAKLLNHEDSHVTTAVRGTVGHIAPEYLSTGQSSEKT 452