BLASTX nr result
ID: Angelica22_contig00026695
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00026695 (313 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275090.1| PREDICTED: probable anion transporter 2, chl... 64 1e-08 >ref|XP_002275090.1| PREDICTED: probable anion transporter 2, chloroplastic-like [Vitis vinifera] Length = 615 Score = 63.9 bits (154), Expect = 1e-08 Identities = 34/75 (45%), Positives = 44/75 (58%), Gaps = 3/75 (4%) Frame = -2 Query: 222 LPNVLPPQQFLHNIKDRRRTKGICECHLSSTPSHSNWIQPRNLGEFGIVDNQFQQLKH-- 49 LP L ++ RRR +GIC+C+LSS PS S+WIQP GI D+Q Q +H Sbjct: 94 LPMSLQSSDKFWSVNPRRRIQGICKCYLSSNPSLSSWIQPSKRARLGISDSQSQSSEHVR 153 Query: 48 -ARTQINYKSEEDDI 7 RT+ YKS+E DI Sbjct: 154 FGRTRSAYKSKEYDI 168