BLASTX nr result
ID: Angelica22_contig00026641
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00026641 (202 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533362.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002533362.1| conserved hypothetical protein [Ricinus communis] gi|223526802|gb|EEF29024.1| conserved hypothetical protein [Ricinus communis] Length = 412 Score = 54.7 bits (130), Expect = 8e-06 Identities = 31/67 (46%), Positives = 39/67 (58%), Gaps = 1/67 (1%) Frame = +3 Query: 3 ELELYYRHIALYGDPSNRNPNSSVDSPVRGIQRSKEIQMIQRGLPDSEFI-GTSGTNCNF 179 ELELYYRHIALYGDP++RN S +DSP + S E++ L F G S T + Sbjct: 272 ELELYYRHIALYGDPNDRNLLSVLDSPTNDFKESGELRKESNYLSSHGFAPGVSETEDDS 331 Query: 180 ADDDSSE 200 D + SE Sbjct: 332 TDSEVSE 338