BLASTX nr result
ID: Angelica22_contig00026373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00026373 (412 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526868.1| Exostosin-2, putative [Ricinus communis] gi|... 85 5e-15 ref|XP_003544111.1| PREDICTED: exostosin-2-like [Glycine max] 85 7e-15 ref|NP_191142.1| nucleotide-diphospho-sugar transferase-like pro... 84 1e-14 ref|XP_003519384.1| PREDICTED: exostosin-2-like [Glycine max] 83 3e-14 emb|CBI25511.3| unnamed protein product [Vitis vinifera] 82 5e-14 >ref|XP_002526868.1| Exostosin-2, putative [Ricinus communis] gi|223533767|gb|EEF35499.1| Exostosin-2, putative [Ricinus communis] Length = 329 Score = 85.1 bits (209), Expect = 5e-15 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +3 Query: 3 TGISSLGGHVEKRTECVNRFVAEFGRMPLVATSVKAVDSRDTWFW 137 TGISSLGGH EKRT+CVNRFVAE+GRMPL++T+VKAVDSR WFW Sbjct: 285 TGISSLGGHSEKRTQCVNRFVAEYGRMPLISTTVKAVDSRHAWFW 329 >ref|XP_003544111.1| PREDICTED: exostosin-2-like [Glycine max] Length = 334 Score = 84.7 bits (208), Expect = 7e-15 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +3 Query: 3 TGISSLGGHVEKRTECVNRFVAEFGRMPLVATSVKAVDSRDTWFW 137 TGISSLGGH E+RTECVNRFVA +GRMPLV+TSVKAVDSR+ WFW Sbjct: 290 TGISSLGGHSERRTECVNRFVAAYGRMPLVSTSVKAVDSRNIWFW 334 >ref|NP_191142.1| nucleotide-diphospho-sugar transferase-like protein [Arabidopsis thaliana] gi|7573478|emb|CAB87837.1| putative protein [Arabidopsis thaliana] gi|110736936|dbj|BAF00425.1| hypothetical protein [Arabidopsis thaliana] gi|332645925|gb|AEE79446.1| nucleotide-diphospho-sugar transferase-like protein [Arabidopsis thaliana] Length = 334 Score = 84.0 bits (206), Expect = 1e-14 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = +3 Query: 3 TGISSLGGHVEKRTECVNRFVAEFGRMPLVATSVKAVDSRDTWFW 137 TGISS+GGH EKRT CVNRFVAEFG+MPLV TS+KAVDSR+ WFW Sbjct: 290 TGISSIGGHTEKRTHCVNRFVAEFGKMPLVYTSMKAVDSRNLWFW 334 >ref|XP_003519384.1| PREDICTED: exostosin-2-like [Glycine max] Length = 332 Score = 82.8 bits (203), Expect = 3e-14 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = +3 Query: 3 TGISSLGGHVEKRTECVNRFVAEFGRMPLVATSVKAVDSRDTWFW 137 TGISSLGGH E+RTECVNRF A +GRMPLV+TSVKAVDSR+ WFW Sbjct: 288 TGISSLGGHSERRTECVNRFAAVYGRMPLVSTSVKAVDSRNIWFW 332 >emb|CBI25511.3| unnamed protein product [Vitis vinifera] Length = 351 Score = 82.0 bits (201), Expect = 5e-14 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = +3 Query: 3 TGISSLGGHVEKRTECVNRFVAEFGRMPLVATSVKAVDSRDTWFW 137 TGISSLGGH EKR++CVNRF E+GRMPLV+TS+KAVDSR +WFW Sbjct: 307 TGISSLGGHTEKRSQCVNRFAMEYGRMPLVSTSMKAVDSRSSWFW 351