BLASTX nr result
ID: Angelica22_contig00026352
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00026352 (649 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004166457.1| PREDICTED: uncharacterized protein LOC101228... 72 1e-10 ref|XP_004140160.1| PREDICTED: uncharacterized protein LOC101218... 72 1e-10 dbj|BAJ33941.1| unnamed protein product [Thellungiella halophila] 71 2e-10 ref|NP_197632.1| Rho GTPase activating protein with PAK-box/P21-... 71 2e-10 ref|XP_002523821.1| gtpase activating protein, putative [Ricinus... 71 2e-10 >ref|XP_004166457.1| PREDICTED: uncharacterized protein LOC101228216 [Cucumis sativus] Length = 828 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/51 (68%), Positives = 39/51 (76%) Frame = -3 Query: 155 DQLSLLGVWFTVFRKSFIACKSSESVIESMEIGVPRNVRHVAHVTFDRFNG 3 DQLSLL + T+FRKS IACKS + +MEIG P NVRHV HVTFDRFNG Sbjct: 87 DQLSLLALVVTLFRKSLIACKSDRRELCAMEIGWPTNVRHVTHVTFDRFNG 137 >ref|XP_004140160.1| PREDICTED: uncharacterized protein LOC101218373 [Cucumis sativus] Length = 784 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/51 (68%), Positives = 39/51 (76%) Frame = -3 Query: 155 DQLSLLGVWFTVFRKSFIACKSSESVIESMEIGVPRNVRHVAHVTFDRFNG 3 DQLSLL + T+FRKS IACKS + +MEIG P NVRHV HVTFDRFNG Sbjct: 43 DQLSLLALVVTLFRKSLIACKSDRRELCAMEIGWPTNVRHVTHVTFDRFNG 93 >dbj|BAJ33941.1| unnamed protein product [Thellungiella halophila] Length = 461 Score = 71.2 bits (173), Expect = 2e-10 Identities = 33/51 (64%), Positives = 40/51 (78%) Frame = -3 Query: 155 DQLSLLGVWFTVFRKSFIACKSSESVIESMEIGVPRNVRHVAHVTFDRFNG 3 DQLSLL + +FRKS ++CK++ + SMEIG P NVRHVAHVTFDRFNG Sbjct: 84 DQLSLLALLVAIFRKSLVSCKTNRRELCSMEIGWPTNVRHVAHVTFDRFNG 134 >ref|NP_197632.1| Rho GTPase activating protein with PAK-box/P21-Rho-binding domain [Arabidopsis thaliana] gi|9757821|dbj|BAB08339.1| rac GTPase activating protein [Arabidopsis thaliana] gi|110738325|dbj|BAF01090.1| rac GTPase activating protein [Arabidopsis thaliana] gi|111074188|gb|ABH04467.1| At5g22400 [Arabidopsis thaliana] gi|332005639|gb|AED93022.1| Rho GTPase activating protein with PAK-box/P21-Rho-binding domain [Arabidopsis thaliana] Length = 466 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/51 (64%), Positives = 40/51 (78%) Frame = -3 Query: 155 DQLSLLGVWFTVFRKSFIACKSSESVIESMEIGVPRNVRHVAHVTFDRFNG 3 DQ+SLL + +FR+S I+CKS+ + SMEIG P NVRHVAHVTFDRFNG Sbjct: 86 DQISLLALLVAIFRRSLISCKSNRRELCSMEIGWPTNVRHVAHVTFDRFNG 136 >ref|XP_002523821.1| gtpase activating protein, putative [Ricinus communis] gi|223536909|gb|EEF38547.1| gtpase activating protein, putative [Ricinus communis] Length = 493 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = -3 Query: 155 DQLSLLGVWFTVFRKSFIACKSSESVIESMEIGVPRNVRHVAHVTFDRFNG 3 +QLSLL + T+FRKS ACKS + +MEIG P NVRHVAHVTFDRFNG Sbjct: 72 EQLSLLALLVTIFRKSLAACKSDRRELCAMEIGWPSNVRHVAHVTFDRFNG 122