BLASTX nr result
ID: Angelica22_contig00026318
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00026318 (511 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK37793.1| unknown [Medicago truncatula] 59 4e-07 ref|XP_003611004.1| Ethylene-responsive transcription factor ERF... 59 4e-07 ref|XP_002509951.1| DNA binding protein, putative [Ricinus commu... 59 5e-07 ref|XP_003516719.1| PREDICTED: ethylene-responsive transcription... 57 2e-06 >gb|AFK37793.1| unknown [Medicago truncatula] Length = 320 Score = 58.9 bits (141), Expect = 4e-07 Identities = 30/46 (65%), Positives = 32/46 (69%) Frame = +1 Query: 100 GLWMDVNSPYSVLGACSAVPEELELEGCSLAHMPSFDPELIWEVLA 237 G+W NSP SV + V EE E E CSLA MPSFDPELIWEVLA Sbjct: 277 GIWKGENSPNSV---STMVTEETEFEDCSLARMPSFDPELIWEVLA 319 >ref|XP_003611004.1| Ethylene-responsive transcription factor ERF061 [Medicago truncatula] gi|355512339|gb|AES93962.1| Ethylene-responsive transcription factor ERF061 [Medicago truncatula] Length = 320 Score = 58.9 bits (141), Expect = 4e-07 Identities = 30/46 (65%), Positives = 32/46 (69%) Frame = +1 Query: 100 GLWMDVNSPYSVLGACSAVPEELELEGCSLAHMPSFDPELIWEVLA 237 G+W NSP SV + V EE E E CSLA MPSFDPELIWEVLA Sbjct: 277 GIWKGENSPNSV---STMVTEETEFEDCSLARMPSFDPELIWEVLA 319 >ref|XP_002509951.1| DNA binding protein, putative [Ricinus communis] gi|223549850|gb|EEF51338.1| DNA binding protein, putative [Ricinus communis] Length = 315 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/47 (63%), Positives = 32/47 (68%), Gaps = 1/47 (2%) Frame = +1 Query: 100 GLWMDVNSPYSVLGACSA-VPEELELEGCSLAHMPSFDPELIWEVLA 237 G W NSP SV CS VP+ +E E CSLA MPSFDPELIW VLA Sbjct: 268 GFWKCENSPPSVSTDCSILVPQVMEFEDCSLARMPSFDPELIWAVLA 314 >ref|XP_003516719.1| PREDICTED: ethylene-responsive transcription factor ERF061-like [Glycine max] Length = 314 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/47 (61%), Positives = 30/47 (63%), Gaps = 2/47 (4%) Frame = +1 Query: 100 GLWMDVNS--PYSVLGACSAVPEELELEGCSLAHMPSFDPELIWEVL 234 G W NS P SVL C EL EGCSLA +PSFDPELIWEVL Sbjct: 266 GFWKGENSHSPASVLTECQTEETELLFEGCSLARLPSFDPELIWEVL 312