BLASTX nr result
ID: Angelica22_contig00026229
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00026229 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003524191.1| PREDICTED: pentatricopeptide repeat-containi... 75 6e-12 emb|CBI21005.3| unnamed protein product [Vitis vinifera] 75 6e-12 ref|XP_002320276.1| predicted protein [Populus trichocarpa] gi|2... 75 6e-12 ref|XP_002282464.1| PREDICTED: pentatricopeptide repeat-containi... 75 6e-12 ref|XP_004157162.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 74 1e-11 >ref|XP_003524191.1| PREDICTED: pentatricopeptide repeat-containing protein At2g25580-like [Glycine max] Length = 664 Score = 75.1 bits (183), Expect = 6e-12 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -2 Query: 287 AMKIISKLVGRELIMRDAKRFHHFKDGVCSCRDYW 183 A+KIISKLVGRELI+RDAKRFHHFKDG+CSCRDYW Sbjct: 630 ALKIISKLVGRELIIRDAKRFHHFKDGLCSCRDYW 664 >emb|CBI21005.3| unnamed protein product [Vitis vinifera] Length = 676 Score = 75.1 bits (183), Expect = 6e-12 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -2 Query: 287 AMKIISKLVGRELIMRDAKRFHHFKDGVCSCRDYW 183 A+KIISKLVGRELI+RDAKRFHHFKDG+CSCRDYW Sbjct: 642 ALKIISKLVGRELIIRDAKRFHHFKDGLCSCRDYW 676 >ref|XP_002320276.1| predicted protein [Populus trichocarpa] gi|222861049|gb|EEE98591.1| predicted protein [Populus trichocarpa] Length = 336 Score = 75.1 bits (183), Expect = 6e-12 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 287 AMKIISKLVGRELIMRDAKRFHHFKDGVCSCRDYW 183 AMKIISKLVGR+LIMRDAKRFHHFKDGVCSC DYW Sbjct: 302 AMKIISKLVGRQLIMRDAKRFHHFKDGVCSCGDYW 336 >ref|XP_002282464.1| PREDICTED: pentatricopeptide repeat-containing protein At2g25580 [Vitis vinifera] Length = 807 Score = 75.1 bits (183), Expect = 6e-12 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -2 Query: 287 AMKIISKLVGRELIMRDAKRFHHFKDGVCSCRDYW 183 A+KIISKLVGRELI+RDAKRFHHFKDG+CSCRDYW Sbjct: 773 ALKIISKLVGRELIIRDAKRFHHFKDGLCSCRDYW 807 >ref|XP_004157162.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g25580-like [Cucumis sativus] Length = 731 Score = 74.3 bits (181), Expect = 1e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = -2 Query: 287 AMKIISKLVGRELIMRDAKRFHHFKDGVCSCRDYW 183 A+KIISK+VGRELI+RDAKRFHHFKDG+CSCRDYW Sbjct: 697 ALKIISKIVGRELIIRDAKRFHHFKDGLCSCRDYW 731