BLASTX nr result
ID: Angelica22_contig00025986
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00025986 (698 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAD94148.1| hypothetical protein [Arabidopsis thaliana] 57 5e-06 >dbj|BAD94148.1| hypothetical protein [Arabidopsis thaliana] Length = 38 Score = 56.6 bits (135), Expect = 5e-06 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +1 Query: 187 MDLIVAGISLMIGLGLFAFITSILCSAAFFQNAKDLS 297 MDLIVAGISLM+GLG FA I SILCS AFF +AK S Sbjct: 1 MDLIVAGISLMVGLGFFALIASILCSVAFFHHAKAAS 37