BLASTX nr result
ID: Angelica22_contig00025965
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00025965 (208 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAW63130.1| 31 kDa putative protein [Strawberry latent ringsp... 59 3e-07 >gb|AAW63130.1| 31 kDa putative protein [Strawberry latent ringspot virus satellite RNA] Length = 287 Score = 59.3 bits (142), Expect = 3e-07 Identities = 33/60 (55%), Positives = 36/60 (60%) Frame = -1 Query: 181 VAIPGQTPQEAASLSREFAKRALVFSGRRLMPVGLPEDHSTDPFASPLPRGPVPARRVVH 2 V PGQT EA +L REF KR L FSGRRL GLP +DPFASP P P +V H Sbjct: 153 VPCPGQTLPEAEALQREFHKRTLAFSGRRLSVSGLPS--GSDPFASPSPVRPALTPKVAH 210