BLASTX nr result
ID: Angelica22_contig00025952
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00025952 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588450.1| Amino acid transporter [Medicago truncatula]... 64 1e-08 ref|XP_003526513.1| PREDICTED: amino acid permease 6-like [Glyci... 61 8e-08 ref|NP_001242816.1| uncharacterized protein LOC100777963 [Glycin... 61 8e-08 ref|XP_002865746.1| hypothetical protein ARALYDRAFT_495022 [Arab... 61 1e-07 gb|AFK42490.1| unknown [Medicago truncatula] 60 2e-07 >ref|XP_003588450.1| Amino acid transporter [Medicago truncatula] gi|355477498|gb|AES58701.1| Amino acid transporter [Medicago truncatula] Length = 472 Score = 64.3 bits (155), Expect = 1e-08 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -1 Query: 285 WLKILSWVCLAVSIVAAAGSIQGLVTDLKTYKPFK 181 WLKILSW+CL +SI++AAGSIQGL T LKTYKPF+ Sbjct: 435 WLKILSWLCLVISIISAAGSIQGLATSLKTYKPFR 469 >ref|XP_003526513.1| PREDICTED: amino acid permease 6-like [Glycine max] Length = 479 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 285 WLKILSWVCLAVSIVAAAGSIQGLVTDLKTYKPFK 181 WLKILSW CL VSI++AAGSIQGL DLK Y+PFK Sbjct: 442 WLKILSWACLIVSIISAAGSIQGLAQDLKKYQPFK 476 >ref|NP_001242816.1| uncharacterized protein LOC100777963 [Glycine max] gi|255642183|gb|ACU21356.1| unknown [Glycine max] Length = 479 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 285 WLKILSWVCLAVSIVAAAGSIQGLVTDLKTYKPFK 181 WLKILSW CL VSI++AAGSIQGL DLK Y+PFK Sbjct: 442 WLKILSWACLIVSIISAAGSIQGLAQDLKKYQPFK 476 >ref|XP_002865746.1| hypothetical protein ARALYDRAFT_495022 [Arabidopsis lyrata subsp. lyrata] gi|297311581|gb|EFH42005.1| hypothetical protein ARALYDRAFT_495022 [Arabidopsis lyrata subsp. lyrata] Length = 507 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -1 Query: 285 WLKILSWVCLAVSIVAAAGSIQGLVTDLKTYKPFK 181 WLKILSW C VSIVAAAGS+QGL+T LK +KPF+ Sbjct: 471 WLKILSWACFVVSIVAAAGSVQGLITSLKDFKPFQ 505 >gb|AFK42490.1| unknown [Medicago truncatula] Length = 482 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -1 Query: 285 WLKILSWVCLAVSIVAAAGSIQGLVTDLKTYKPFK 181 W+KILSW CL VSI++AAGSIQGL DLK Y+PFK Sbjct: 445 WMKILSWACLIVSIISAAGSIQGLAHDLKKYQPFK 479