BLASTX nr result
ID: Angelica22_contig00025880
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00025880 (332 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138221.1| PREDICTED: uncharacterized protein LOC101214... 63 3e-08 ref|XP_003551255.1| PREDICTED: uncharacterized protein LOC100814... 63 3e-08 ref|XP_003528260.1| PREDICTED: uncharacterized protein LOC100792... 63 3e-08 ref|XP_002511997.1| conserved hypothetical protein [Ricinus comm... 63 3e-08 gb|ACJ84318.1| unknown [Medicago truncatula] gi|388515575|gb|AFK... 63 3e-08 >ref|XP_004138221.1| PREDICTED: uncharacterized protein LOC101214386 [Cucumis sativus] gi|449477117|ref|XP_004154934.1| PREDICTED: uncharacterized LOC101214386 [Cucumis sativus] Length = 262 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 330 VVGSRDSEAFYMMNPDSNGAPELSVYLLRV 241 VVGSRDSEAFYMMNPDSNGAPELS+YLLRV Sbjct: 233 VVGSRDSEAFYMMNPDSNGAPELSIYLLRV 262 >ref|XP_003551255.1| PREDICTED: uncharacterized protein LOC100814991 [Glycine max] Length = 316 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 330 VVGSRDSEAFYMMNPDSNGAPELSVYLLRV 241 +VGSRDSEAFYMMNPDSNGAPELSVYLLRV Sbjct: 287 IVGSRDSEAFYMMNPDSNGAPELSVYLLRV 316 >ref|XP_003528260.1| PREDICTED: uncharacterized protein LOC100792218 [Glycine max] Length = 333 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 330 VVGSRDSEAFYMMNPDSNGAPELSVYLLRV 241 +VGSRDSEAFYMMNPDSNGAPELSVYLLRV Sbjct: 304 IVGSRDSEAFYMMNPDSNGAPELSVYLLRV 333 >ref|XP_002511997.1| conserved hypothetical protein [Ricinus communis] gi|223549177|gb|EEF50666.1| conserved hypothetical protein [Ricinus communis] Length = 256 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 330 VVGSRDSEAFYMMNPDSNGAPELSVYLLRV 241 +VGSRDSEAFYMMNPDSNGAPELSVYLLRV Sbjct: 227 IVGSRDSEAFYMMNPDSNGAPELSVYLLRV 256 >gb|ACJ84318.1| unknown [Medicago truncatula] gi|388515575|gb|AFK45849.1| unknown [Medicago truncatula] Length = 255 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 330 VVGSRDSEAFYMMNPDSNGAPELSVYLLRV 241 +VGSRDSEAFYMMNPDSNGAPELSVYLLRV Sbjct: 226 IVGSRDSEAFYMMNPDSNGAPELSVYLLRV 255