BLASTX nr result
ID: Angelica22_contig00025805
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00025805 (428 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002891080.1| pentatricopeptide repeat-containing protein ... 55 8e-06 >ref|XP_002891080.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297336922|gb|EFH67339.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 562 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = +2 Query: 317 VFDEMSVRDVTCWNVLIYGLAHGSRPSDALEMYKEME 427 +FDEMSVRDV WN LI GL G+R S+ALE+YK ME Sbjct: 165 LFDEMSVRDVASWNALIAGLVAGNRASEALELYKRME 201