BLASTX nr result
ID: Angelica22_contig00025427
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00025427 (360 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276932.1| PREDICTED: uncharacterized protein LOC100266... 67 2e-09 ref|XP_002518977.1| transcription factor, putative [Ricinus comm... 62 4e-08 ref|XP_002326545.1| jumonji domain protein [Populus trichocarpa]... 57 2e-06 >ref|XP_002276932.1| PREDICTED: uncharacterized protein LOC100266131 [Vitis vinifera] Length = 884 Score = 66.6 bits (161), Expect = 2e-09 Identities = 34/51 (66%), Positives = 42/51 (82%), Gaps = 2/51 (3%) Frame = -1 Query: 147 GRACFSRDAE--LEFLKNKRLQRIKSETANHTLHVRNVMTRSGGDALRASS 1 GR C SR+A+ LEFL++KRLQR+KS TA+ T+ V N+MTRSGGDALR SS Sbjct: 12 GRVCLSREAKNGLEFLRHKRLQRMKSRTADQTVSVSNMMTRSGGDALRPSS 62 >ref|XP_002518977.1| transcription factor, putative [Ricinus communis] gi|223541964|gb|EEF43510.1| transcription factor, putative [Ricinus communis] Length = 780 Score = 62.4 bits (150), Expect = 4e-08 Identities = 32/51 (62%), Positives = 39/51 (76%), Gaps = 2/51 (3%) Frame = -1 Query: 147 GRACFSRDAE--LEFLKNKRLQRIKSETANHTLHVRNVMTRSGGDALRASS 1 GR C S++A LEFLK KRLQR+KSET T+ V + M+RSGGDALRAS+ Sbjct: 4 GRVCLSKEARNGLEFLKRKRLQRMKSETLTETVSVTSTMSRSGGDALRASA 54 >ref|XP_002326545.1| jumonji domain protein [Populus trichocarpa] gi|222833867|gb|EEE72344.1| jumonji domain protein [Populus trichocarpa] Length = 873 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/51 (56%), Positives = 39/51 (76%), Gaps = 2/51 (3%) Frame = -1 Query: 147 GRACFSRDAE--LEFLKNKRLQRIKSETANHTLHVRNVMTRSGGDALRASS 1 GR C SR+A LE+LK++RLQR+KSE+ T+ V N+M+RS GD LRAS+ Sbjct: 4 GRVCLSREARNGLEYLKHRRLQRMKSESVTETVSVPNMMSRSRGDNLRASA 54