BLASTX nr result
ID: Angelica22_contig00025386
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00025386 (450 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC84135.1| cytochrome [Cichorium intybus] 87 1e-15 sp|P00070.3|CYC_HELAN RecName: Full=Cytochrome c gi|1235929|gb|A... 86 2e-15 ref|XP_002458876.1| hypothetical protein SORBIDRAFT_03g042000 [S... 85 5e-15 gb|AFX66977.1| cytochrome c [Solanum tuberosum] 85 7e-15 sp|P00061.1|CYC_SOLTU RecName: Full=Cytochrome c 85 7e-15 >gb|AAC84135.1| cytochrome [Cichorium intybus] Length = 112 Score = 87.4 bits (215), Expect = 1e-15 Identities = 41/42 (97%), Positives = 41/42 (97%) Frame = +2 Query: 2 NTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIVYLKSSTA 127 NTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLI YLKSSTA Sbjct: 71 NTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKSSTA 112 >sp|P00070.3|CYC_HELAN RecName: Full=Cytochrome c gi|1235929|gb|AAA92712.1| cytochrome c [Helianthus annuus] Length = 112 Score = 86.3 bits (212), Expect = 2e-15 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +2 Query: 2 NTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIVYLKSSTA 127 NTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLI YLK+STA Sbjct: 71 NTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKTSTA 112 >ref|XP_002458876.1| hypothetical protein SORBIDRAFT_03g042000 [Sorghum bicolor] gi|241930851|gb|EES03996.1| hypothetical protein SORBIDRAFT_03g042000 [Sorghum bicolor] Length = 112 Score = 85.1 bits (209), Expect = 5e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +2 Query: 2 NTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIVYLKSSTA 127 NTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLI YLK++TA Sbjct: 71 NTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKNATA 112 >gb|AFX66977.1| cytochrome c [Solanum tuberosum] Length = 112 Score = 84.7 bits (208), Expect = 7e-15 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +2 Query: 2 NTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIVYLKSSTA 127 NTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLI YLK +TA Sbjct: 71 NTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKEATA 112 >sp|P00061.1|CYC_SOLTU RecName: Full=Cytochrome c Length = 111 Score = 84.7 bits (208), Expect = 7e-15 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +2 Query: 2 NTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIVYLKSSTA 127 NTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLI YLK +TA Sbjct: 70 NTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKEATA 111