BLASTX nr result
ID: Angelica22_contig00025193
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00025193 (362 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513279.1| Protein regulator of cytokinesis, putative [... 74 1e-11 ref|XP_004148126.1| PREDICTED: 65-kDa microtubule-associated pro... 61 1e-07 ref|XP_002267584.1| PREDICTED: 65-kDa microtubule-associated pro... 60 1e-07 >ref|XP_002513279.1| Protein regulator of cytokinesis, putative [Ricinus communis] gi|223547653|gb|EEF49147.1| Protein regulator of cytokinesis, putative [Ricinus communis] Length = 724 Score = 73.9 bits (180), Expect = 1e-11 Identities = 35/50 (70%), Positives = 39/50 (78%) Frame = +1 Query: 4 SIPMQTGMTPAPPHPVAYIATTPIKDVPEETEYSFEERRAGFVLPGTHPK 153 S+PMQT +TPA P PV Y TP ++VPEE EYSFEERRAGFVLP TH K Sbjct: 671 SVPMQTAITPAHPVPVPYGGATPKEEVPEEVEYSFEERRAGFVLPRTHIK 720 >ref|XP_004148126.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Cucumis sativus] gi|449499658|ref|XP_004160877.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Cucumis sativus] Length = 730 Score = 60.8 bits (146), Expect = 1e-07 Identities = 33/55 (60%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +1 Query: 4 SIPMQTGMTPAPPHPVAYIATTPIKDVPEETEYSFEERRAGFVLP-GTHPKIQLQ 165 S+PMQT MTPA PHPV A +D+ E EYSFEERRAGFVLP H K +Q Sbjct: 676 SVPMQTAMTPALPHPVDLTARIS-EDISEVVEYSFEERRAGFVLPKALHIKAMIQ 729 >ref|XP_002267584.1| PREDICTED: 65-kDa microtubule-associated protein 3 [Vitis vinifera] gi|296084125|emb|CBI24513.3| unnamed protein product [Vitis vinifera] Length = 730 Score = 60.5 bits (145), Expect = 1e-07 Identities = 35/55 (63%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +1 Query: 4 SIPMQTGMTPAPPH-PVAYIATTPIKDVPEETEYSFEERRAGFVLPGTHPKIQLQ 165 S+PM T MTPAPP PV Y A P+ EETEYSFEERRAGFVLP H K +Q Sbjct: 680 SVPMLTAMTPAPPPAPVPYNAN-PV----EETEYSFEERRAGFVLPQAHLKTAIQ 729