BLASTX nr result
ID: Angelica22_contig00024968
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00024968 (359 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528886.1| S-locus-specific glycoprotein S6 precursor, ... 55 5e-06 >ref|XP_002528886.1| S-locus-specific glycoprotein S6 precursor, putative [Ricinus communis] gi|223531685|gb|EEF33510.1| S-locus-specific glycoprotein S6 precursor, putative [Ricinus communis] Length = 614 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 1 RPTMATVGLMLTSEIPLPQPKEPGFFSERKLHGGD 105 RPTM+TV LMLTS+I LPQPKEPGFF+ERK+ D Sbjct: 558 RPTMSTVVLMLTSDISLPQPKEPGFFTERKVFEQD 592