BLASTX nr result
ID: Angelica22_contig00024901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00024901 (1059 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK13856.1| Ty3/gypsy retrotransposon protein [Beta vulgaris ... 65 2e-08 gb|AAK91129.1| KRP120-2 [Daucus carota] 62 3e-07 >gb|AFK13856.1| Ty3/gypsy retrotransposon protein [Beta vulgaris subsp. vulgaris] Length = 1631 Score = 65.5 bits (158), Expect = 2e-08 Identities = 33/54 (61%), Positives = 41/54 (75%), Gaps = 2/54 (3%) Frame = -2 Query: 1058 FEATWEDVTSINARFPLFHLEDKVNLWQGGIVMNQPKP--LVTYRRSRKRTKGK 903 FEATWED++ I+ RFP FHLEDKVN+W GIVM+Q K L+TY+R R KG+ Sbjct: 1571 FEATWEDMSPIHLRFPSFHLEDKVNVWGAGIVMHQLKKPNLITYKR-RGNKKGQ 1623 >gb|AAK91129.1| KRP120-2 [Daucus carota] Length = 1045 Score = 61.6 bits (148), Expect = 3e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 90 MESNGSRRGGGSFVSISPSQTPKSSEKAIR 1 MESNGSRRGGGSFVSISPSQTPKSSEKAIR Sbjct: 1 MESNGSRRGGGSFVSISPSQTPKSSEKAIR 30