BLASTX nr result
ID: Angelica22_contig00024752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00024752 (264 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN06064.1| RNA-directed DNA polymerase (Reverse transcriptas... 52 2e-08 gb|ACP30609.1| disease resistance protein [Brassica rapa subsp. ... 49 1e-07 gb|ACY01928.1| hypothetical protein [Beta vulgaris] 49 1e-07 gb|AFK13856.1| Ty3/gypsy retrotransposon protein [Beta vulgaris ... 49 2e-07 gb|AAF13073.1|AC011621_1 putative retroelement pol polyprotein [... 51 6e-07 >gb|ABN06064.1| RNA-directed DNA polymerase (Reverse transcriptase); Chromo; Zinc finger, CCHC-type; Peptidase aspartic, active site; Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula] Length = 1297 Score = 52.0 bits (123), Expect(2) = 2e-08 Identities = 16/35 (45%), Positives = 25/35 (71%) Frame = +2 Query: 131 MENHLRCFFSGQPRTWTQWLPWLEDWYDTSFQVST 235 +E +LRCF + QP+ W W+PW E W++TS+ +T Sbjct: 1042 LETYLRCFIADQPKNWASWIPWAEYWFNTSYHAAT 1076 Score = 31.2 bits (69), Expect(2) = 2e-08 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 40 VFLSLIWKELFKAEGTKL 93 +F+S WKELFK +GTKL Sbjct: 1004 IFMSNFWKELFKLQGTKL 1021 >gb|ACP30609.1| disease resistance protein [Brassica rapa subsp. pekinensis] Length = 2726 Score = 48.9 bits (115), Expect(2) = 1e-07 Identities = 19/34 (55%), Positives = 24/34 (70%) Frame = +2 Query: 131 MENHLRCFFSGQPRTWTQWLPWLEDWYDTSFQVS 232 ME +LRCF S PRTW ++L W E WY+TSF + Sbjct: 2451 METYLRCFASSHPRTWHKFLSWAELWYNTSFHTA 2484 Score = 31.6 bits (70), Expect(2) = 1e-07 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = +1 Query: 40 VFLSLIWKELFKAEGTKL 93 VFLS WK+LF+A GTKL Sbjct: 2413 VFLSSFWKDLFRASGTKL 2430 >gb|ACY01928.1| hypothetical protein [Beta vulgaris] Length = 1583 Score = 48.9 bits (115), Expect(2) = 1e-07 Identities = 17/35 (48%), Positives = 25/35 (71%) Frame = +2 Query: 131 MENHLRCFFSGQPRTWTQWLPWLEDWYDTSFQVST 235 +E +LRCF +G+P+ W QW+ W E WY+TS S+ Sbjct: 1283 LEAYLRCFCNGRPKAWAQWISWAEYWYNTSTHSSS 1317 Score = 31.6 bits (70), Expect(2) = 1e-07 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = +1 Query: 40 VFLSLIWKELFKAEGTKL 93 VF+SL WKELFK +GT L Sbjct: 1245 VFMSLFWKELFKLQGTLL 1262 >gb|AFK13856.1| Ty3/gypsy retrotransposon protein [Beta vulgaris subsp. vulgaris] Length = 1631 Score = 49.3 bits (116), Expect(2) = 2e-07 Identities = 19/35 (54%), Positives = 24/35 (68%) Frame = +2 Query: 131 MENHLRCFFSGQPRTWTQWLPWLEDWYDTSFQVST 235 +E +LRCF G PR+W +WLPW E Y+TS ST Sbjct: 1350 LETYLRCFVGGHPRSWAKWLPWAEFSYNTSPHTST 1384 Score = 30.4 bits (67), Expect(2) = 2e-07 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +1 Query: 40 VFLSLIWKELFKAEGTKL 93 +FLSL WKELF+ GT L Sbjct: 1312 IFLSLFWKELFRLHGTTL 1329 >gb|AAF13073.1|AC011621_1 putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1661 Score = 51.2 bits (121), Expect(2) = 6e-07 Identities = 18/35 (51%), Positives = 26/35 (74%) Frame = +2 Query: 131 MENHLRCFFSGQPRTWTQWLPWLEDWYDTSFQVST 235 +E++LRCF +P +W QWLPW E WY+TS+ +T Sbjct: 1376 LESYLRCFAGRRPTSWFQWLPWAEYWYNTSYHSAT 1410 Score = 26.9 bits (58), Expect(2) = 6e-07 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 40 VFLSLIWKELFKAEGTKL 93 +FLS W ELFK +GT L Sbjct: 1338 IFLSGFWSELFKLQGTGL 1355