BLASTX nr result
ID: Angelica22_contig00024690
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00024690 (484 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADE41124.1| AP2 domain class transcription factor [Malus x do... 57 2e-06 ref|XP_002511592.1| Ethylene-responsive transcription factor, pu... 56 3e-06 ref|XP_002872976.1| hypothetical protein ARALYDRAFT_912253 [Arab... 55 4e-06 gb|AAM65925.1| putative ethylene response element binding protei... 55 6e-06 ref|NP_182011.1| ethylene-responsive transcription factor 13 [Ar... 55 6e-06 >gb|ADE41124.1| AP2 domain class transcription factor [Malus x domestica] Length = 278 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/50 (56%), Positives = 33/50 (66%) Frame = -2 Query: 483 WLGTYETXXXXXXXXXXXAFKIHGSAAKLNFPHLIGRDIPEPIKVTPRQR 334 WLGTYET AFKI GS AKLNFPHLIG + EP++VT ++R Sbjct: 156 WLGTYETAEGAALAYDQAAFKIRGSKAKLNFPHLIGSEGYEPVRVTVKRR 205 >ref|XP_002511592.1| Ethylene-responsive transcription factor, putative [Ricinus communis] gi|223548772|gb|EEF50261.1| Ethylene-responsive transcription factor, putative [Ricinus communis] Length = 223 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/51 (52%), Positives = 34/51 (66%) Frame = -2 Query: 483 WLGTYETXXXXXXXXXXXAFKIHGSAAKLNFPHLIGRDIPEPIKVTPRQRA 331 WLGTYET AFK+ G+ AKLNFPHLIG D EP++V+ R+R+ Sbjct: 126 WLGTYETPEDAALAYDRAAFKMRGTKAKLNFPHLIGSDDLEPVRVSNRRRS 176 >ref|XP_002872976.1| hypothetical protein ARALYDRAFT_912253 [Arabidopsis lyrata subsp. lyrata] gi|297318813|gb|EFH49235.1| hypothetical protein ARALYDRAFT_912253 [Arabidopsis lyrata subsp. lyrata] Length = 162 Score = 55.5 bits (132), Expect = 4e-06 Identities = 30/54 (55%), Positives = 34/54 (62%), Gaps = 3/54 (5%) Frame = -2 Query: 483 WLGTYETXXXXXXXXXXXAFKIHGSAAKLNFPHLIGRDIPEPIKVT---PRQRA 331 WLGTYET AFK+ GS AKLNFPHLIG D EP++VT RQR+ Sbjct: 71 WLGTYETPEEAAVAYDQAAFKMRGSKAKLNFPHLIGIDQAEPVRVTNGNKRQRS 124 >gb|AAM65925.1| putative ethylene response element binding protein (EREBP) [Arabidopsis thaliana] Length = 226 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/51 (50%), Positives = 33/51 (64%) Frame = -2 Query: 483 WLGTYETXXXXXXXXXXXAFKIHGSAAKLNFPHLIGRDIPEPIKVTPRQRA 331 WLGTYET AF++ GS AKLNFPHLIG EP+++ PR+R+ Sbjct: 118 WLGTYETPEDAAVAYDRAAFQLRGSKAKLNFPHLIGSCKYEPVRIRPRRRS 168 >ref|NP_182011.1| ethylene-responsive transcription factor 13 [Arabidopsis thaliana] gi|57012834|sp|Q8L9K1.2|ERF99_ARATH RecName: Full=Ethylene-responsive transcription factor 13; Short=AtERF13; AltName: Full=Ethylene-responsive element-binding factor 13; Short=EREBP-13 gi|13272437|gb|AAK17157.1|AF325089_1 putative ethylene response element binding protein (EREBP) [Arabidopsis thaliana] gi|13899091|gb|AAK48967.1|AF370540_1 putative ethylene response element binding protein; EREBP [Arabidopsis thaliana] gi|2344900|gb|AAC31840.1| putative ethylene response element binding protein (EREBP) [Arabidopsis thaliana] gi|18377440|gb|AAL66886.1| putative ethylene response element binding protein (EREBP) [Arabidopsis thaliana] gi|330255379|gb|AEC10473.1| ethylene-responsive transcription factor 13 [Arabidopsis thaliana] Length = 226 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/51 (50%), Positives = 33/51 (64%) Frame = -2 Query: 483 WLGTYETXXXXXXXXXXXAFKIHGSAAKLNFPHLIGRDIPEPIKVTPRQRA 331 WLGTYET AF++ GS AKLNFPHLIG EP+++ PR+R+ Sbjct: 118 WLGTYETPEDAAVAYDRAAFQLRGSKAKLNFPHLIGSCKYEPVRIRPRRRS 168