BLASTX nr result
ID: Angelica22_contig00024604
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00024604 (283 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAC53943.1| DnaJ homolog [Nicotiana tabacum] 76 2e-20 ref|XP_003605980.1| DnaJ [Medicago truncatula] gi|355507035|gb|A... 75 7e-20 ref|XP_003605981.1| DnaJ [Medicago truncatula] gi|355507036|gb|A... 75 7e-20 gb|AFK48086.1| unknown [Medicago truncatula] 75 7e-20 gb|ACJ83716.1| unknown [Medicago truncatula] 75 7e-20 >dbj|BAC53943.1| DnaJ homolog [Nicotiana tabacum] Length = 339 Score = 76.3 bits (186), Expect(2) = 2e-20 Identities = 34/48 (70%), Positives = 42/48 (87%) Frame = -3 Query: 191 LFIEHSSFLSEALCGFQFMSTHLEGR*LLIKSEPGKVIKPDQFKGIND 48 LF+EH+ L+EALCGFQF+ THL+ R LLIKS+PG+V+KPDQFK IND Sbjct: 194 LFVEHTLSLTEALCGFQFILTHLDNRQLLIKSQPGEVVKPDQFKAIND 241 Score = 47.4 bits (111), Expect(2) = 2e-20 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = -1 Query: 283 EADEAPDMVTRDRVFVLQ*KEHPEFRRKGD 194 EADEAPD +T D VF+LQ KEHP+F+RK D Sbjct: 163 EADEAPDTITGDIVFILQQKEHPKFKRKED 192 >ref|XP_003605980.1| DnaJ [Medicago truncatula] gi|355507035|gb|AES88177.1| DnaJ [Medicago truncatula] Length = 416 Score = 74.7 bits (182), Expect(2) = 7e-20 Identities = 33/48 (68%), Positives = 41/48 (85%) Frame = -3 Query: 191 LFIEHSSFLSEALCGFQFMSTHLEGR*LLIKSEPGKVIKPDQFKGIND 48 LF+EH+ L+EALCGFQF+ THL+GR LLIKS PG+V+KPD +K IND Sbjct: 270 LFVEHTLSLTEALCGFQFVLTHLDGRQLLIKSNPGEVVKPDSYKAIND 317 Score = 47.4 bits (111), Expect(2) = 7e-20 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = -1 Query: 283 EADEAPDMVTRDRVFVLQ*KEHPEFRRKGD 194 EADEAPD VT D VFVLQ KEHP+F+RK + Sbjct: 239 EADEAPDTVTGDIVFVLQQKEHPKFKRKSE 268 >ref|XP_003605981.1| DnaJ [Medicago truncatula] gi|355507036|gb|AES88178.1| DnaJ [Medicago truncatula] Length = 413 Score = 74.7 bits (182), Expect(2) = 7e-20 Identities = 33/48 (68%), Positives = 41/48 (85%) Frame = -3 Query: 191 LFIEHSSFLSEALCGFQFMSTHLEGR*LLIKSEPGKVIKPDQFKGIND 48 LF+EH+ L+EALCGFQF+ THL+GR LLIKS PG+V+KPD +K IND Sbjct: 267 LFVEHTLSLTEALCGFQFVLTHLDGRQLLIKSNPGEVVKPDSYKAIND 314 Score = 47.4 bits (111), Expect(2) = 7e-20 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = -1 Query: 283 EADEAPDMVTRDRVFVLQ*KEHPEFRRKGD 194 EADEAPD VT D VFVLQ KEHP+F+RK + Sbjct: 236 EADEAPDTVTGDIVFVLQQKEHPKFKRKSE 265 >gb|AFK48086.1| unknown [Medicago truncatula] Length = 227 Score = 74.7 bits (182), Expect(2) = 7e-20 Identities = 33/48 (68%), Positives = 41/48 (85%) Frame = -3 Query: 191 LFIEHSSFLSEALCGFQFMSTHLEGR*LLIKSEPGKVIKPDQFKGIND 48 LF+EH+ L+EALCGFQF+ THL+GR LLIKS PG+V+KPD +K IND Sbjct: 81 LFVEHTLSLTEALCGFQFVLTHLDGRQLLIKSNPGEVVKPDSYKAIND 128 Score = 47.4 bits (111), Expect(2) = 7e-20 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = -1 Query: 283 EADEAPDMVTRDRVFVLQ*KEHPEFRRKGD 194 EADEAPD VT D VFVLQ KEHP+F+RK + Sbjct: 50 EADEAPDTVTGDIVFVLQQKEHPKFKRKSE 79 >gb|ACJ83716.1| unknown [Medicago truncatula] Length = 156 Score = 74.7 bits (182), Expect(2) = 7e-20 Identities = 33/48 (68%), Positives = 41/48 (85%) Frame = -3 Query: 191 LFIEHSSFLSEALCGFQFMSTHLEGR*LLIKSEPGKVIKPDQFKGIND 48 LF+EH+ L+EALCGFQF+ THL+GR LLIKS PG+V+KPD +K IND Sbjct: 43 LFVEHTLSLTEALCGFQFVLTHLDGRQLLIKSNPGEVVKPDSYKAIND 90 Score = 47.4 bits (111), Expect(2) = 7e-20 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = -1 Query: 283 EADEAPDMVTRDRVFVLQ*KEHPEFRRKGD 194 EADEAPD VT D VFVLQ KEHP+F+RK + Sbjct: 12 EADEAPDTVTGDIVFVLQQKEHPKFKRKSE 41