BLASTX nr result
ID: Angelica22_contig00024575
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00024575 (527 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300876.1| predicted protein [Populus trichocarpa] gi|2... 75 8e-12 ref|XP_003551921.1| PREDICTED: probable receptor-like protein ki... 74 1e-11 ref|XP_002526652.1| ATP binding protein, putative [Ricinus commu... 72 4e-11 ref|XP_003617422.1| Receptor-like protein kinase [Medicago trunc... 70 2e-10 ref|XP_002283589.2| PREDICTED: probable receptor-like protein ki... 69 3e-10 >ref|XP_002300876.1| predicted protein [Populus trichocarpa] gi|222842602|gb|EEE80149.1| predicted protein [Populus trichocarpa] Length = 508 Score = 74.7 bits (182), Expect = 8e-12 Identities = 37/59 (62%), Positives = 50/59 (84%) Frame = +1 Query: 1 PKMSQVVQMLEADDFPYREDRRNRKTRTTSMEIESIKESCDSVDVDSQARESETRRPET 177 PKM+QVV+MLEAD++P REDRRNRKTRTTSMEIES++E +S + +++ +SE+R ET Sbjct: 449 PKMTQVVRMLEADEYPLREDRRNRKTRTTSMEIESMRE--ESTESENKGVDSESRLAET 505 >ref|XP_003551921.1| PREDICTED: probable receptor-like protein kinase At2g42960-like [Glycine max] Length = 510 Score = 73.9 bits (180), Expect = 1e-11 Identities = 37/61 (60%), Positives = 47/61 (77%) Frame = +1 Query: 1 PKMSQVVQMLEADDFPYREDRRNRKTRTTSMEIESIKESCDSVDVDSQARESETRRPETL 180 PKMSQVV+MLEAD++P+REDRRNRK+RT SMEIES+K+ D + + + SE PET Sbjct: 450 PKMSQVVRMLEADEYPFREDRRNRKSRTASMEIESLKDISGPSDAE-KLKGSEGHEPETT 508 Query: 181 Q 183 Q Sbjct: 509 Q 509 >ref|XP_002526652.1| ATP binding protein, putative [Ricinus communis] gi|223534019|gb|EEF35740.1| ATP binding protein, putative [Ricinus communis] Length = 509 Score = 72.4 bits (176), Expect = 4e-11 Identities = 36/58 (62%), Positives = 48/58 (82%) Frame = +1 Query: 1 PKMSQVVQMLEADDFPYREDRRNRKTRTTSMEIESIKESCDSVDVDSQARESETRRPE 174 PKMSQVV+MLEAD++P+ EDRRNRK+RTTSMEIES+KE S D++++ +SE+ E Sbjct: 449 PKMSQVVRMLEADEYPFHEDRRNRKSRTTSMEIESMKE---SNDIENKVGDSESTANE 503 >ref|XP_003617422.1| Receptor-like protein kinase [Medicago truncatula] gi|355518757|gb|AET00381.1| Receptor-like protein kinase [Medicago truncatula] Length = 507 Score = 70.1 bits (170), Expect = 2e-10 Identities = 34/59 (57%), Positives = 47/59 (79%) Frame = +1 Query: 1 PKMSQVVQMLEADDFPYREDRRNRKTRTTSMEIESIKESCDSVDVDSQARESETRRPET 177 PKMSQVV+MLEAD++P+REDRRNRK+ TTS+EIE++K+ D ++A S++ PET Sbjct: 445 PKMSQVVRMLEADEYPFREDRRNRKSSTTSLEIETVKDISGPSDA-AKAEHSKSNVPET 502 >ref|XP_002283589.2| PREDICTED: probable receptor-like protein kinase At2g42960-like [Vitis vinifera] Length = 503 Score = 69.3 bits (168), Expect = 3e-10 Identities = 34/60 (56%), Positives = 47/60 (78%) Frame = +1 Query: 1 PKMSQVVQMLEADDFPYREDRRNRKTRTTSMEIESIKESCDSVDVDSQARESETRRPETL 180 PKMSQVV+MLE D++P+REDR RK+RTTSM++ES+KE+ S DV+++ ESE E + Sbjct: 444 PKMSQVVRMLEQDEYPFREDR--RKSRTTSMDLESMKENSGSGDVENKVNESECHTSEAI 501