BLASTX nr result
ID: Angelica22_contig00024527
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00024527 (319 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518327.1| hypothetical protein RCOM_0817990 [Ricinus c... 55 8e-06 >ref|XP_002518327.1| hypothetical protein RCOM_0817990 [Ricinus communis] gi|223542547|gb|EEF44087.1| hypothetical protein RCOM_0817990 [Ricinus communis] Length = 423 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/56 (46%), Positives = 36/56 (64%) Frame = -1 Query: 172 DGEESDRENGYGSSFIDRPSCYHETPTYRTRYPGAVRLRAYMFDGLGNYTNKDWDL 5 + EE+DRE + + RP Y++R+PG VR +AY+FDG GNY NK+WDL Sbjct: 13 ESEETDREASGDTPLMGRPF-------YQSRFPGMVRQKAYIFDGDGNYYNKEWDL 61