BLASTX nr result
ID: Angelica22_contig00024496
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00024496 (180 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_23143178.1| hypothetical protein LEP2GSC003_RS09365, part... 68 9e-10 >ref|ZP_23143178.1| hypothetical protein LEP2GSC003_RS09365, partial [Leptospira interrogans serovar Manilae str. M776_fur_mutant] Length = 81 Score = 67.8 bits (164), Expect = 9e-10 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +2 Query: 47 VMWILDSGCSRHMTGDRALLTDVVEKAGPVVTFGDNNK 160 V+WI+DSGCSRHMTGD+ALL+ E AGP+VTFGDNNK Sbjct: 1 VIWIIDSGCSRHMTGDKALLSQFEEMAGPLVTFGDNNK 38