BLASTX nr result
ID: Angelica22_contig00024354
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00024354 (343 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002311563.1| predicted protein [Populus trichocarpa] gi|2... 96 6e-21 ref|XP_002315829.1| predicted protein [Populus trichocarpa] gi|2... 92 2e-20 ref|XP_002521882.1| pentatricopeptide repeat-containing protein,... 93 7e-20 ref|XP_004171323.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 94 3e-19 ref|XP_004149471.1| PREDICTED: uncharacterized protein At4g15970... 94 3e-19 >ref|XP_002311563.1| predicted protein [Populus trichocarpa] gi|222851383|gb|EEE88930.1| predicted protein [Populus trichocarpa] Length = 277 Score = 95.5 bits (236), Expect(2) = 6e-21 Identities = 40/60 (66%), Positives = 55/60 (91%) Frame = +3 Query: 159 ISCNHYSGDSADIERNKPNGGFSFVRSNGPSIEFYKYWYAAQETYPGLHDQDVLNRIKYD 338 I+C+H+SG+S+DI+ N+PNGGF++V+SN SIEFYK+WY+++ETYPG HDQDVLN IK+D Sbjct: 139 IACDHFSGNSSDIQ-NRPNGGFNYVKSNKRSIEFYKFWYSSRETYPGFHDQDVLNFIKFD 197 Score = 30.0 bits (66), Expect(2) = 6e-21 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +2 Query: 116 MWFRDPYSLLYLDSDF 163 MWFRDP+ +LD+DF Sbjct: 122 MWFRDPFPRFFLDADF 137 >ref|XP_002315829.1| predicted protein [Populus trichocarpa] gi|222864869|gb|EEF02000.1| predicted protein [Populus trichocarpa] Length = 404 Score = 92.4 bits (228), Expect(2) = 2e-20 Identities = 38/60 (63%), Positives = 54/60 (90%) Frame = +3 Query: 159 ISCNHYSGDSADIERNKPNGGFSFVRSNGPSIEFYKYWYAAQETYPGLHDQDVLNRIKYD 338 I+C+H+ G+S+DI+ N+PNGGF++V+SN +IEFYK+WY+++ETYPG HDQDVLN IK+D Sbjct: 245 IACDHFLGNSSDIQ-NRPNGGFNYVKSNNRTIEFYKFWYSSRETYPGYHDQDVLNFIKFD 303 Score = 31.6 bits (70), Expect(2) = 2e-20 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +2 Query: 116 MWFRDPYSLLYLDSDF 163 MWFRDP+ YLD+DF Sbjct: 228 MWFRDPFPRFYLDADF 243 >ref|XP_002521882.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223538920|gb|EEF40518.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 394 Score = 92.8 bits (229), Expect(2) = 7e-20 Identities = 39/58 (67%), Positives = 52/58 (89%) Frame = +3 Query: 159 ISCNHYSGDSADIERNKPNGGFSFVRSNGPSIEFYKYWYAAQETYPGLHDQDVLNRIK 332 I+C+H++G S +I NKPNGGF++VRSN SIEFYK+WY+++ETYPG+HDQDVLN+IK Sbjct: 237 IACDHFTGSSINIH-NKPNGGFNYVRSNNRSIEFYKFWYSSRETYPGIHDQDVLNKIK 293 Score = 29.3 bits (64), Expect(2) = 7e-20 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +2 Query: 116 MWFRDPYSLLYLDSDF 163 MWFRDP+ Y D+DF Sbjct: 220 MWFRDPFPRFYSDADF 235 >ref|XP_004171323.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At4g15970-like [Cucumis sativus] Length = 350 Score = 94.0 bits (232), Expect(2) = 3e-19 Identities = 41/60 (68%), Positives = 51/60 (85%) Frame = +3 Query: 159 ISCNHYSGDSADIERNKPNGGFSFVRSNGPSIEFYKYWYAAQETYPGLHDQDVLNRIKYD 338 I+C+ Y G D++ N+PNGGF++V+SN SIEFYKYWY+A+ETYPG HDQDVLNRIKYD Sbjct: 210 IACDQYLGIPDDLD-NRPNGGFNYVKSNNRSIEFYKYWYSARETYPGYHDQDVLNRIKYD 268 Score = 25.8 bits (55), Expect(2) = 3e-19 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 116 MWFRDPYSLLYLDSDF 163 MWFRDP+ +++DF Sbjct: 193 MWFRDPFPFFDINADF 208 >ref|XP_004149471.1| PREDICTED: uncharacterized protein At4g15970-like [Cucumis sativus] Length = 350 Score = 94.0 bits (232), Expect(2) = 3e-19 Identities = 41/60 (68%), Positives = 51/60 (85%) Frame = +3 Query: 159 ISCNHYSGDSADIERNKPNGGFSFVRSNGPSIEFYKYWYAAQETYPGLHDQDVLNRIKYD 338 I+C+ Y G D++ N+PNGGF++V+SN SIEFYKYWY+A+ETYPG HDQDVLNRIKYD Sbjct: 210 IACDQYLGIPDDLD-NRPNGGFNYVKSNNRSIEFYKYWYSARETYPGYHDQDVLNRIKYD 268 Score = 25.8 bits (55), Expect(2) = 3e-19 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 116 MWFRDPYSLLYLDSDF 163 MWFRDP+ +++DF Sbjct: 193 MWFRDPFPFFDINADF 208